Clone MIP11416 Report

Search the DGRC for MIP11416

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:114
Well:16
Vector:pOTB7_DraIII
Associated Gene/TranscriptCheB38b-RA
Protein status:MIP11416.pep: gold
Sequenced Size:759

Clone Sequence Records

MIP11416.complete Sequence

759 bp assembled on 2009-06-25

GenBank Submission: BT088863.1

> MIP11416.complete
AGGGCAAAATGATTCGAGGCCTGGTGATTCTTGTTTTGGCCCTGGCCAAC
ACTTGGGCAACGGACTACAACGCTCTGATTGACGATGAGGGCATCTACGT
GAAGTGCTCAGAAGCCCCAGCCGGTACCCTTGGTCCCCGCGATGTATTTA
ACATTGACAATATGGTGATGCATATGGAACCAGAAGGCATTTACGTATCG
GGGAATATGACCGTTAAACTCAACTTTCTACCCTCCGATCGCATTTCCGC
TAGGTTCAGCGTGATGCACTATGAACGTGGTAGTTGGCAACCCACAATGT
TCAACCTTCACTCCCCGAACTTTTGTGAGGTGATGTTTGACGAAGATCAA
TACTGGTTCAAGTATTGGTTCAGATATATACGAAACAAAGAGGAGATTCG
AGAAAAATGCTTGAAAGTGAAAGATACCGTGCTAGTGTATGATGAGTTCT
TGATGGTCCTGCACCTAGAAAATGTCAATACCTCAAACTTACAGGGGCGC
TACAAGGCGGTGATTACTCTGGAGGCTTTCGATGAACATAATGTGCGACG
ACCATCATCCCTCTGCGTTGAAATAAGAGGCGACCTTGAGAGGGTTACCT
AGTTACACAATTTTGTATAACCTTACACACTTTTGTTGTATGTTTTTCTA
ATAATCTTACAATTTAATAATCATACACTTATGTGGCAGAAAAGCAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGAAAAAAAAAAAAAAAA
AAAAAAAAA

MIP11416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CheB38b-RA 751 CheB38b-RA 54..749 1..696 3480 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20814960..20815230 696..426 1310 98.9 Minus
chr2L 23010047 chr2L 20815527..20815775 249..1 1245 100 Minus
chr2L 23010047 chr2L 20815290..20815466 425..249 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20816455..20816725 696..426 1355 100 Minus
2L 23513712 2L 20817022..20817270 249..1 1245 100 Minus
2L 23513712 2L 20816785..20816961 425..249 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20816455..20816725 696..426 1355 100 Minus
2L 23513712 2L 20817022..20817270 249..1 1245 100 Minus
2L 23513712 2L 20816785..20816961 425..249 885 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:20:34 has no hits.

MIP11416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:21:21 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20815528..20815775 1..248 100   Minus
chr2L 20814967..20815230 426..689 98 <- Minus
chr2L 20815290..20815466 249..425 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:07 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..594 9..602 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:49 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..594 9..602 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:57 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..594 9..602 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:48 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..594 9..602 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-25 17:31:40 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..594 9..602 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:49 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..689 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:57 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..689 1..689 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:48 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
CheB38b-RA 1..689 1..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:21 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20816462..20816725 426..689 100 <- Minus
2L 20816785..20816961 249..425 100 <- Minus
2L 20817023..20817270 1..248 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:21 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20816462..20816725 426..689 100 <- Minus
2L 20816785..20816961 249..425 100 <- Minus
2L 20817023..20817270 1..248 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:21 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20816462..20816725 426..689 100 <- Minus
2L 20816785..20816961 249..425 100 <- Minus
2L 20817023..20817270 1..248 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:57 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20816462..20816725 426..689 100 <- Minus
arm_2L 20816785..20816961 249..425 100 <- Minus
arm_2L 20817023..20817270 1..248 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:29 Download gff for MIP11416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20816462..20816725 426..689 100 <- Minus
2L 20816785..20816961 249..425 100 <- Minus
2L 20817023..20817270 1..248 100   Minus

MIP11416.hyp Sequence

Translation from 2 to 601

> MIP11416.hyp
GKMIRGLVILVLALANTWATDYNALIDDEGIYVKCSEAPAGTLGPRDVFN
IDNMVMHMEPEGIYVSGNMTVKLNFLPSDRISARFSVMHYERGSWQPTMF
NLHSPNFCEVMFDEDQYWFKYWFRYIRNKEEIREKCLKVKDTVLVYDEFL
MVLHLENVNTSNLQGRYKAVITLEAFDEHNVRRPSSLCVEIRGDLERVT*

MIP11416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CheB38b-PA 197 CG33321-PA 1..197 3..199 1050 100 Plus
CheB38c-PA 198 CG14405-PA 1..196 3..198 523 46.9 Plus
CheB42c-PB 196 CG33350-PB 1..195 4..198 510 44.6 Plus
CheB42b-PA 196 CG33351-PA 4..191 7..194 485 42 Plus
CheB38a-PA 197 CG33320-PA 1..196 3..198 476 42.3 Plus

MIP11416.pep Sequence

Translation from 2 to 601

> MIP11416.pep
GKMIRGLVILVLALANTWATDYNALIDDEGIYVKCSEAPAGTLGPRDVFN
IDNMVMHMEPEGIYVSGNMTVKLNFLPSDRISARFSVMHYERGSWQPTMF
NLHSPNFCEVMFDEDQYWFKYWFRYIRNKEEIREKCLKVKDTVLVYDEFL
MVLHLENVNTSNLQGRYKAVITLEAFDEHNVRRPSSLCVEIRGDLERVT*

MIP11416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11757-PA 196 GF11757-PA 1..196 3..198 531 43.9 Plus
Dana\GF11760-PA 198 GF11760-PA 7..197 8..198 437 36.1 Plus
Dana\GF13150-PA 200 GF13150-PA 20..199 19..197 306 33.7 Plus
Dana\GF19949-PA 204 GF19949-PA 27..201 22..198 271 31.8 Plus
Dana\GF19881-PA 147 GF19881-PA 7..140 3..136 236 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21547-PA 197 GG21547-PA 1..196 3..198 902 83.2 Plus
Dere\GG10785-PA 196 GG10785-PA 1..195 4..198 535 45.6 Plus
Dere\GG21546-PA 198 GG21546-PA 1..196 3..198 505 44.9 Plus
Dere\GG10786-PA 196 GG10786-PA 4..191 7..194 496 43.6 Plus
Dere\GG23235-PA 198 GG23235-PA 7..198 7..198 347 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19861-PA 1785 GH19861-PA 10..196 12..194 394 36.4 Plus
Dgri\GH19860-PA 198 GH19860-PA 5..198 7..198 378 34.4 Plus
Dgri\GH11359-PA 200 GH11359-PA 6..200 2..198 298 30.5 Plus
Dgri\GH11360-PA 193 GH11360-PA 4..193 7..198 294 29.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
CheB38b-PA 197 CG33321-PA 1..197 3..199 1050 100 Plus
CheB38c-PA 198 CG14405-PA 1..196 3..198 523 46.9 Plus
CheB42c-PB 196 CG33350-PB 1..195 4..198 510 44.6 Plus
CheB42b-PA 196 CG33351-PA 4..191 7..194 485 42 Plus
CheB38a-PA 197 CG33320-PA 1..196 3..198 476 42.3 Plus
CheB74a-PA 202 CG33924-PA 26..201 22..198 359 34.5 Plus
CheB42a-PA 198 CG33348-PA 7..198 7..198 351 34.7 Plus
CheB53a-PA 226 CG33550-PA 4..190 7..194 329 33 Plus
CheB53b-PA 204 CG33524-PA 11..200 7..197 299 29.8 Plus
CheB98a-PB 197 CG14531-PB 5..195 9..198 276 28.4 Plus
CheB93b-PA 203 CG31438-PA 12..203 7..198 240 26.3 Plus
CheB93a-PA 200 CG15503-PA 27..197 21..195 237 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19808-PA 199 GI19808-PA 19..199 19..198 457 45.3 Plus
Dmoj\GI24073-PA 201 GI24073-PA 5..200 1..198 349 32.8 Plus
Dmoj\GI18506-PA 196 GI18506-PA 2..196 2..198 276 31 Plus
Dmoj\GI23608-PA 200 GI23608-PA 6..200 2..198 276 31.5 Plus
Dmoj\GI24062-PA 146 GI24062-PA 3..146 50..199 259 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10962-PA 197 GL10962-PA 1..196 3..198 538 44.9 Plus
Dper\GL27150-PA 201 GL27150-PA 11..201 7..198 383 33.9 Plus
Dper\GL13801-PA 200 GL13801-PA 11..200 8..198 342 30.4 Plus
Dper\GL11129-PA 202 GL11129-PA 22..202 19..198 329 34.6 Plus
Dper\GL27336-PA 199 GL27336-PA 24..199 22..199 305 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24546-PA 197 GA24546-PA 1..196 3..198 535 44.9 Plus
Dpse\GA16252-PA 201 GA16252-PA 11..201 7..198 382 33.9 Plus
Dpse\GA13057-PA 200 GA13057-PA 10..200 8..198 346 32.3 Plus
Dpse\GA24619-PA 202 GA24619-PA 22..202 19..198 337 35.7 Plus
Dpse\GA27041-PA 199 GA27041-PA 24..199 22..199 305 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23304-PA 197 GM23304-PA 1..197 3..199 978 90.9 Plus
Dsec\GM20835-PA 196 GM20835-PA 1..195 4..198 528 45.1 Plus
Dsec\GM20836-PA 196 GM20836-PA 4..191 7..194 475 39.9 Plus
Dsec\GM23303-PA 195 GM23303-PA 1..193 3..198 440 39.8 Plus
Dsec\GM23302-PA 166 GM23302-PA 1..164 3..198 411 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21678-PA 197 GD21678-PA 1..197 3..199 981 90.9 Plus
Dsim\GD10288-PA 196 GD10288-PA 1..195 4..198 523 44.6 Plus
Dsim\GD21677-PA 198 GD21677-PA 1..196 3..198 500 43.9 Plus
Dsim\GD10289-PA 196 GD10289-PA 4..191 7..194 473 40.4 Plus
Dsim\GD21676-PA 166 GD21676-PA 1..164 3..198 411 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18474-PA 199 GJ18474-PA 19..199 19..198 432 39.8 Plus
Dvir\GJ23996-PA 200 GJ23996-PA 5..200 1..198 348 33.3 Plus
Dvir\GJ23975-PA 200 GJ23975-PA 6..200 2..198 338 32.5 Plus
Dvir\GJ23997-PA 200 GJ23997-PA 5..200 1..198 337 32.3 Plus
Dvir\GJ18835-PA 191 GJ18835-PA 7..175 7..175 137 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21541-PA 201 GK21541-PA 7..197 7..198 445 41.1 Plus
Dwil\GK12101-PA 208 GK12101-PA 8..196 7..194 326 33.7 Plus
Dwil\GK10987-PA 200 GK10987-PA 5..197 6..197 302 31.4 Plus
Dwil\GK21768-PA 205 GK21768-PA 6..205 2..198 250 26.7 Plus
Dwil\GK18906-PA 203 GK18906-PA 1..196 3..195 245 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13541-PA 197 GE13541-PA 1..196 3..198 920 85.2 Plus
Dyak\GE24346-PA 196 GE24346-PA 1..195 4..198 532 45.6 Plus
Dyak\GE13540-PA 197 GE13540-PA 1..196 3..198 526 47.4 Plus
Dyak\GE24356-PA 196 GE24356-PA 4..191 7..194 480 41 Plus
Dyak\GE19086-PA 197 GE19086-PA 8..197 7..198 363 37.8 Plus