MIP11501.complete Sequence
406 bp assembled on 2009-06-25
GenBank Submission: BT088864.1
> MIP11501.complete
ATCAAATCACAAATCACTGCAATCGCTACACAAGCACCTCAAGTCCCAAG
GAAAATCAAAGCAAACAACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTG
CCCTCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAAT
CCCGCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTA
CGGAGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACT
CCTACTACGGCTAAGTGCCCCGGACCATGCATTGCAATGCAAAGCGACAA
ACGACTCGTGATTATGCATCTGAATACGGATTACGGATATGCGCGTGCTG
GCAAATCAAATTAGTCATAAGTGCTCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
MIP11501.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:32:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-RA | 711 | Nplp4-RA | 227..627 | 1..400 | 1875 | 98.2 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:20:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 2008424..2008718 | 81..375 | 1460 | 99.7 | Plus |
chr2L | 23010047 | chr2L | 2008212..2008293 | 1..81 | 360 | 98.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:20:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2008672..2008991 | 81..400 | 1510 | 98.1 | Plus |
2L | 23513712 | 2L | 2008460..2008541 | 1..81 | 360 | 98.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2008672..2008991 | 81..400 | 1510 | 98.1 | Plus |
2L | 23513712 | 2L | 2008460..2008541 | 1..81 | 370 | 98.7 | Plus |
Blast to na_te.dros performed on 2019-03-16 04:20:26 has no hits.
MIP11501.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:21:17 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 2008425..2008718 | 82..376 | 99 | | Plus |
chr2L | 2008212..2008293 | 1..81 | 98 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:06 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..195 | 70..264 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:52 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..195 | 70..264 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:47 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..195 | 70..264 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:38 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..195 | 70..264 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-25 17:31:38 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..195 | 70..264 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:52 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 1..376 | 1..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:47 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 5..380 | 1..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:38 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 5..380 | 1..375 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008460..2008541 | 1..81 | 98 | -> | Plus |
2L | 2008673..2008966 | 82..376 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008460..2008541 | 1..81 | 98 | -> | Plus |
2L | 2008673..2008966 | 82..376 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008460..2008541 | 1..81 | 98 | -> | Plus |
2L | 2008673..2008966 | 82..376 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:47 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2008460..2008541 | 1..81 | 98 | -> | Plus |
arm_2L | 2008673..2008966 | 82..376 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:32 Download gff for
MIP11501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008673..2008966 | 82..376 | 99 | | Plus |
2L | 2008460..2008541 | 1..81 | 98 | -> | Plus |
MIP11501.hyp Sequence
Translation from 2 to 363
> MIP11501.hyp
QITNHCNRYTSTSSPQGKSKQTTCSSCWLSFSLPSSPLLWLFPLQLPVPI
PPQSRLPAPSPPPSTTTELAHTPTPEDTTIRPTPTTAKCPGPCIAMQSDK
RLVIMHLNTDYGYARAGKSN*
Sequence MIP11501.hyp has no blast hits.
MIP11501.pep Sequence
Translation from 69 to 263
> MIP11501.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYG*
MIP11501.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:01:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14594-PA | 66 | GF14594-PA | 33..66 | 31..64 | 146 | 94.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:01:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24821-PA | 64 | GG24821-PA | 1..64 | 1..64 | 203 | 95.3 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:01:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10868-PA | 65 | GH10868-PA | 16..65 | 16..64 | 149 | 72 | Plus |
Dgri\GH25211-PA | 65 | GH25211-PA | 16..65 | 16..64 | 149 | 72 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-PB | 64 | CG15361-PB | 1..64 | 1..64 | 339 | 100 | Plus |
Nplp4-PA | 64 | CG15361-PA | 1..64 | 1..64 | 339 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:01:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI18243-PA | 65 | GI18243-PA | 1..65 | 1..64 | 132 | 73.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:01:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16845-PA | 64 | GM16845-PA | 1..64 | 1..64 | 285 | 96.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:01:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23125-PA | 64 | GD23125-PA | 1..64 | 1..64 | 285 | 96.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:01:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15080-PA | 65 | GK15080-PA | 22..65 | 20..64 | 148 | 80 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:01:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17867-PA | 64 | GE17867-PA | 1..64 | 1..64 | 287 | 98.4 | Plus |