Clone MIP11501 Report

Search the DGRC for MIP11501

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:115
Well:1
Vector:pOTB7_DraIII
Associated Gene/TranscriptNplp4-RA
Protein status:MIP11501.pep: gold
Sequenced Size:406

Clone Sequence Records

MIP11501.complete Sequence

406 bp assembled on 2009-06-25

GenBank Submission: BT088864.1

> MIP11501.complete
ATCAAATCACAAATCACTGCAATCGCTACACAAGCACCTCAAGTCCCAAG
GAAAATCAAAGCAAACAACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTG
CCCTCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAAT
CCCGCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTA
CGGAGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACT
CCTACTACGGCTAAGTGCCCCGGACCATGCATTGCAATGCAAAGCGACAA
ACGACTCGTGATTATGCATCTGAATACGGATTACGGATATGCGCGTGCTG
GCAAATCAAATTAGTCATAAGTGCTCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

MIP11501.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-RA 711 Nplp4-RA 227..627 1..400 1875 98.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2008424..2008718 81..375 1460 99.7 Plus
chr2L 23010047 chr2L 2008212..2008293 1..81 360 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2008672..2008991 81..400 1510 98.1 Plus
2L 23513712 2L 2008460..2008541 1..81 360 98.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2008672..2008991 81..400 1510 98.1 Plus
2L 23513712 2L 2008460..2008541 1..81 370 98.7 Plus
Blast to na_te.dros performed on 2019-03-16 04:20:26 has no hits.

MIP11501.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:21:17 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2008425..2008718 82..376 99   Plus
chr2L 2008212..2008293 1..81 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:06 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..195 70..264 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:52 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..195 70..264 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:47 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..195 70..264 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:38 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..195 70..264 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-25 17:31:38 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..195 70..264 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:52 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 1..376 1..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:47 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 5..380 1..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:38 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 5..380 1..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008460..2008541 1..81 98 -> Plus
2L 2008673..2008966 82..376 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008460..2008541 1..81 98 -> Plus
2L 2008673..2008966 82..376 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:17 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008460..2008541 1..81 98 -> Plus
2L 2008673..2008966 82..376 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:47 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2008460..2008541 1..81 98 -> Plus
arm_2L 2008673..2008966 82..376 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:32 Download gff for MIP11501.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008673..2008966 82..376 99   Plus
2L 2008460..2008541 1..81 98 -> Plus

MIP11501.hyp Sequence

Translation from 2 to 363

> MIP11501.hyp
QITNHCNRYTSTSSPQGKSKQTTCSSCWLSFSLPSSPLLWLFPLQLPVPI
PPQSRLPAPSPPPSTTTELAHTPTPEDTTIRPTPTTAKCPGPCIAMQSDK
RLVIMHLNTDYGYARAGKSN*
Sequence MIP11501.hyp has no blast hits.

MIP11501.pep Sequence

Translation from 69 to 263

> MIP11501.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYG*

MIP11501.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14594-PA 66 GF14594-PA 33..66 31..64 146 94.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24821-PA 64 GG24821-PA 1..64 1..64 203 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10868-PA 65 GH10868-PA 16..65 16..64 149 72 Plus
Dgri\GH25211-PA 65 GH25211-PA 16..65 16..64 149 72 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-PB 64 CG15361-PB 1..64 1..64 339 100 Plus
Nplp4-PA 64 CG15361-PA 1..64 1..64 339 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18243-PA 65 GI18243-PA 1..65 1..64 132 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16845-PA 64 GM16845-PA 1..64 1..64 285 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23125-PA 64 GD23125-PA 1..64 1..64 285 96.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15080-PA 65 GK15080-PA 22..65 20..64 148 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17867-PA 64 GE17867-PA 1..64 1..64 287 98.4 Plus