BDGP Sequence Production Resources |
Search the DGRC for MIP11526
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 115 |
Well: | 26 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | CG13062-RB |
Protein status: | MIP11526.pep: gold |
Sequenced Size: | 828 |
828 bp assembled on 2009-06-25
GenBank Submission: BT088866.1
> MIP11526.complete AGACTGCAAACTGCAAACTGCGGATGCAAACGCAAGGTTCCACAACATTG AAGCCTCTCAGCAGCGGCGGATATGGCAACGAGAGCATCTGCATCTGCAT CTGCAGCGGAATCCGCAGCTGTTGCTGGTGGCCAATTGGCTAGGTGGCAA GTGAATAAAAGCCACCTCCACACCATCGAGTGGCATCAGTTGAAAGCAGC GAGCTACCAAGACCAACCACCAAGGATTAAACCACCCACAAGATGATGAA ACTGGTAGTGTCGCTACTCTCAATTTGCGCCTTGACGGCAGCTCGTCCTG GTTTCCTGCATGGCCACCACCATCACTATCCGGAAATCCCTTACTATCCA CACCACCATCATGTGGAACCACTGCACTACCATCTGCCCGCCGCCGTCTC CCACCAGAGCTCCACGGTGGTGCACAGTGTGCCGCACCACATAATCAAGC CGGTCCTGCTGCCCACTGTGGTGAAGACAGTGGTGCATCCGCCCATCATC AAGGCTTATCATCCTGCGCCCATCATCAAGGCCTACCACCCCTACGATCC CTTCCATCTGCATCACCATCACGACTTCCACGACTACCATCTGCACTAAA CGACGATCCTGGCGATTGACTGATGAATGATAACGATAACTGATTAACGA TGACGACGACGGGGAGAATGCAACCTTAGTATGCTGTGTATGTTTGCGTG TGTCGATTGTTCCAGTGTAAGGACCAACTGAAGGTTTCGCTGTAAGCTGC TGAATATTCTATTCCATCTATCTGTAATGCTGTACATAAAAGATACAACA CAGAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13062.a | 1009 | CG13062.a | 133..933 | 1..801 | 4005 | 100 | Plus |
CG13062-RA | 600 | CG13062-RA | 256..600 | 255..599 | 1725 | 100 | Plus |
CG13062-RA | 600 | CG13062-RA | 144..256 | 84..196 | 565 | 100 | Plus |
CG13062-RA | 600 | CG13062-RA | 110..145 | 1..36 | 180 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16304010..16304263 | 1..254 | 99 | -> | Plus |
chr3L | 16304328..16304874 | 255..803 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RA | 133..250 | 73..190 | 96 | == | Plus |
CG13062-RA | 251..600 | 247..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..357 | 243..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..357 | 243..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..357 | 243..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RA | 133..250 | 73..190 | 96 | == | Plus |
CG13062-RA | 251..600 | 247..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13062-RB | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16314285..16314538 | 1..254 | 100 | -> | Plus |
3L | 16314603..16315149 | 255..803 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16314285..16314538 | 1..254 | 100 | -> | Plus |
3L | 16314603..16315149 | 255..803 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16314285..16314538 | 1..254 | 100 | -> | Plus |
3L | 16314603..16315149 | 255..803 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16307385..16307638 | 1..254 | 100 | -> | Plus |
arm_3L | 16307703..16308249 | 255..803 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16307385..16307638 | 1..254 | 100 | -> | Plus |
3L | 16307703..16308249 | 255..803 | 99 | Plus |
Translation from 242 to 598
> MIP11526.hyp MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP YDPFHLHHHHDFHDYHLH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13062-PB | 118 | CG13062-PB | 1..118 | 1..118 | 681 | 100 | Plus |
Translation from 242 to 598
> MIP11526.pep MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP YDPFHLHHHHDFHDYHLH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24179-PA | 122 | GF24179-PA | 1..108 | 1..104 | 427 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15983-PA | 155 | GG15983-PA | 40..155 | 3..118 | 547 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15874-PA | 115 | GH15874-PA | 1..105 | 1..104 | 353 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13062-PB | 118 | CG13062-PB | 1..118 | 1..118 | 681 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16524-PA | 121 | GI16524-PA | 18..106 | 18..103 | 297 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17849-PA | 126 | GL17849-PA | 1..109 | 1..104 | 329 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28512-PA | 126 | GA28512-PA | 1..109 | 1..104 | 329 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25615-PA | 200 | GM25615-PA | 87..200 | 5..118 | 556 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14620-PA | 200 | GD14620-PA | 87..200 | 5..118 | 559 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12777-PA | 122 | GJ12777-PA | 18..103 | 18..98 | 265 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16557-PA | 120 | GK16557-PA | 1..114 | 1..112 | 271 | 81.2 | Plus |