Clone MIP11526 Report

Search the DGRC for MIP11526

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:115
Well:26
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13062-RB
Protein status:MIP11526.pep: gold
Sequenced Size:828

Clone Sequence Records

MIP11526.complete Sequence

828 bp assembled on 2009-06-25

GenBank Submission: BT088866.1

> MIP11526.complete
AGACTGCAAACTGCAAACTGCGGATGCAAACGCAAGGTTCCACAACATTG
AAGCCTCTCAGCAGCGGCGGATATGGCAACGAGAGCATCTGCATCTGCAT
CTGCAGCGGAATCCGCAGCTGTTGCTGGTGGCCAATTGGCTAGGTGGCAA
GTGAATAAAAGCCACCTCCACACCATCGAGTGGCATCAGTTGAAAGCAGC
GAGCTACCAAGACCAACCACCAAGGATTAAACCACCCACAAGATGATGAA
ACTGGTAGTGTCGCTACTCTCAATTTGCGCCTTGACGGCAGCTCGTCCTG
GTTTCCTGCATGGCCACCACCATCACTATCCGGAAATCCCTTACTATCCA
CACCACCATCATGTGGAACCACTGCACTACCATCTGCCCGCCGCCGTCTC
CCACCAGAGCTCCACGGTGGTGCACAGTGTGCCGCACCACATAATCAAGC
CGGTCCTGCTGCCCACTGTGGTGAAGACAGTGGTGCATCCGCCCATCATC
AAGGCTTATCATCCTGCGCCCATCATCAAGGCCTACCACCCCTACGATCC
CTTCCATCTGCATCACCATCACGACTTCCACGACTACCATCTGCACTAAA
CGACGATCCTGGCGATTGACTGATGAATGATAACGATAACTGATTAACGA
TGACGACGACGGGGAGAATGCAACCTTAGTATGCTGTGTATGTTTGCGTG
TGTCGATTGTTCCAGTGTAAGGACCAACTGAAGGTTTCGCTGTAAGCTGC
TGAATATTCTATTCCATCTATCTGTAATGCTGTACATAAAAGATACAACA
CAGAAAAAAAAAAAAAAAAAAAAAAAAA

MIP11526.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062.a 1009 CG13062.a 133..933 1..801 4005 100 Plus
CG13062-RA 600 CG13062-RA 256..600 255..599 1725 100 Plus
CG13062-RA 600 CG13062-RA 144..256 84..196 565 100 Plus
CG13062-RA 600 CG13062-RA 110..145 1..36 180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16304327..16304874 254..801 2740 100 Plus
chr3L 24539361 chr3L 16304010..16304266 1..257 1255 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16314602..16315149 254..801 2740 100 Plus
3L 28110227 3L 16314285..16314541 1..257 1285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16307702..16308249 254..801 2740 100 Plus
3L 28103327 3L 16307385..16307641 1..257 1285 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:16:37 has no hits.

MIP11526.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:17:23 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16304010..16304263 1..254 99 -> Plus
chr3L 16304328..16304874 255..803 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:05 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RA 133..250 73..190 96 == Plus
CG13062-RA 251..600 247..599 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:54 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..357 243..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:35 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..357 243..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:58 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..357 243..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-25 17:31:36 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RA 133..250 73..190 96 == Plus
CG13062-RA 251..600 247..599 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:54 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..801 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:35 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..801 1..801 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:58 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 1..801 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:23 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16314285..16314538 1..254 100 -> Plus
3L 16314603..16315149 255..803 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:23 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16314285..16314538 1..254 100 -> Plus
3L 16314603..16315149 255..803 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:23 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16314285..16314538 1..254 100 -> Plus
3L 16314603..16315149 255..803 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:35 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16307385..16307638 1..254 100 -> Plus
arm_3L 16307703..16308249 255..803 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:35 Download gff for MIP11526.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16307385..16307638 1..254 100 -> Plus
3L 16307703..16308249 255..803 99   Plus

MIP11526.hyp Sequence

Translation from 242 to 598

> MIP11526.hyp
MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA
AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP
YDPFHLHHHHDFHDYHLH*

MIP11526.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-PB 118 CG13062-PB 1..118 1..118 681 100 Plus

MIP11526.pep Sequence

Translation from 242 to 598

> MIP11526.pep
MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA
AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP
YDPFHLHHHHDFHDYHLH*

MIP11526.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24179-PA 122 GF24179-PA 1..108 1..104 427 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15983-PA 155 GG15983-PA 40..155 3..118 547 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15874-PA 115 GH15874-PA 1..105 1..104 353 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-PB 118 CG13062-PB 1..118 1..118 681 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16524-PA 121 GI16524-PA 18..106 18..103 297 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17849-PA 126 GL17849-PA 1..109 1..104 329 85.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28512-PA 126 GA28512-PA 1..109 1..104 329 85.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25615-PA 200 GM25615-PA 87..200 5..118 556 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14620-PA 200 GD14620-PA 87..200 5..118 559 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12777-PA 122 GJ12777-PA 18..103 18..98 265 81.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16557-PA 120 GK16557-PA 1..114 1..112 271 81.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23178-PA 160 GE23178-PA 45..160 3..118 541 94.8 Plus
Dyak\GE23098-PA 160 GE23098-PA 45..146 3..104 431 93.1 Plus