MIP11594.complete Sequence
470 bp assembled on 2011-03-07
GenBank Submission: BT126154.1
> MIP11594.complete
ATTCCCACTCCCATAGCTTTTCGAATCGGTCGCTAGTGAAATGAAGAAGC
ATTTGGAAGTGTTCTTGGTCGTGGCATTAGCTGCTCTAGCGGAATTGCCA
GGAGTTACAGCCTCGTCCGTGGAAATACTGTCCCATTGTGTCGCCTGTCC
GGACGAATTTAGGGGCATGTTGGTCTGCGCCTTTATCAACGGTTGCTACT
TGGAAATAGAATACTGCTCCATGGTGGTCTTCAACTGTGGACGCCAACAG
CACCACAAACACTTGTTCCTAGTGGTAAACGAGGGCAAGTGCAAGCCAGT
TCGGGGCTACAAATGCGAGACCATGGATTTTTAAGTTCTGGCGGAGGTTC
TCCGCATTTATTTATTGATGTAATGATTACAATTTAAAGTGCTTAATCTG
AGGGAAATGTGTGACGATTAAAACTTGACAATGTGTCCGGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA
MIP11594.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 3036820..3037082 | 263..1 | 1300 | 99.6 | Minus |
chr2R | 21145070 | chr2R | 3036586..3036763 | 441..264 | 875 | 99.4 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 7149415..7149677 | 263..1 | 1315 | 100 | Minus |
2R | 25286936 | 2R | 7149177..7149358 | 445..264 | 895 | 99.5 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 7150614..7150876 | 263..1 | 1315 | 100 | Minus |
2R | 25260384 | 2R | 7150376..7150557 | 445..264 | 895 | 99.4 | Minus |
Blast to na_te.dros performed on 2019-03-16 22:20:05 has no hits.
MIP11594.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:06 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 3036586..3036763 | 264..441 | 99 | <- | Minus |
chr2R | 3036820..3037082 | 1..263 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:36 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..294 | 41..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:37 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..294 | 41..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:04 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..294 | 41..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:35 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..294 | 41..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:37 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..441 | 1..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:04 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12828-RA | 1..441 | 1..441 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7149181..7149358 | 264..441 | 100 | <- | Minus |
2R | 7149415..7149677 | 1..263 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7149181..7149358 | 264..441 | 100 | <- | Minus |
2R | 7149415..7149677 | 1..263 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7149181..7149358 | 264..441 | 100 | <- | Minus |
2R | 7149415..7149677 | 1..263 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:37 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 3036686..3036863 | 264..441 | 100 | <- | Minus |
arm_2R | 3036920..3037182 | 1..263 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:45 Download gff for
MIP11594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7150614..7150876 | 1..263 | 100 | | Minus |
2R | 7150380..7150557 | 264..441 | 100 | <- | Minus |
MIP11594.hyp Sequence
Translation from 40 to 333
> MIP11594.hyp
MKKHLEVFLVVALAALAELPGVTASSVEILSHCVACPDEFRGMLVCAFIN
GCYLEIEYCSMVVFNCGRQQHHKHLFLVVNEGKCKPVRGYKCETMDF*
MIP11594.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12828-PA | 97 | CG12828-PA | 1..97 | 1..97 | 525 | 100 | Plus |
MIP11594.pep Sequence
Translation from 40 to 333
> MIP11594.pep
MKKHLEVFLVVALAALAELPGVTASSVEILSHCVACPDEFRGMLVCAFIN
GCYLEIEYCSMVVFNCGRQQHHKHLFLVVNEGKCKPVRGYKCETMDF*
MIP11594.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:27:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10768-PA | 97 | GG10768-PA | 20..97 | 20..97 | 350 | 79.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12828-PA | 97 | CG12828-PA | 1..97 | 1..97 | 525 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:27:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20816-PA | 97 | GM20816-PA | 1..97 | 1..97 | 474 | 92.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:27:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10272-PA | 97 | GD10272-PA | 1..97 | 1..97 | 470 | 91.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24202-PA | 97 | GE24202-PA | 1..97 | 1..97 | 434 | 82.5 | Plus |