Clone MIP11594 Report

Search the DGRC for MIP11594

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:115
Well:94
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG12828-RA
Protein status:MIP11594.pep: gold
Sequenced Size:470

Clone Sequence Records

MIP11594.complete Sequence

470 bp assembled on 2011-03-07

GenBank Submission: BT126154.1

> MIP11594.complete
ATTCCCACTCCCATAGCTTTTCGAATCGGTCGCTAGTGAAATGAAGAAGC
ATTTGGAAGTGTTCTTGGTCGTGGCATTAGCTGCTCTAGCGGAATTGCCA
GGAGTTACAGCCTCGTCCGTGGAAATACTGTCCCATTGTGTCGCCTGTCC
GGACGAATTTAGGGGCATGTTGGTCTGCGCCTTTATCAACGGTTGCTACT
TGGAAATAGAATACTGCTCCATGGTGGTCTTCAACTGTGGACGCCAACAG
CACCACAAACACTTGTTCCTAGTGGTAAACGAGGGCAAGTGCAAGCCAGT
TCGGGGCTACAAATGCGAGACCATGGATTTTTAAGTTCTGGCGGAGGTTC
TCCGCATTTATTTATTGATGTAATGATTACAATTTAAAGTGCTTAATCTG
AGGGAAATGTGTGACGATTAAAACTTGACAATGTGTCCGGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

MIP11594.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3036820..3037082 263..1 1300 99.6 Minus
chr2R 21145070 chr2R 3036586..3036763 441..264 875 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7149415..7149677 263..1 1315 100 Minus
2R 25286936 2R 7149177..7149358 445..264 895 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7150614..7150876 263..1 1315 100 Minus
2R 25260384 2R 7150376..7150557 445..264 895 99.4 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:05 has no hits.

MIP11594.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:06 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3036586..3036763 264..441 99 <- Minus
chr2R 3036820..3037082 1..263 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:36 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..294 41..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:37 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..294 41..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:04 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..294 41..334 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:35 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..294 41..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:37 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..441 1..441 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:04 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
CG12828-RA 1..441 1..441 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7149181..7149358 264..441 100 <- Minus
2R 7149415..7149677 1..263 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7149181..7149358 264..441 100 <- Minus
2R 7149415..7149677 1..263 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:06 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7149181..7149358 264..441 100 <- Minus
2R 7149415..7149677 1..263 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:37 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3036686..3036863 264..441 100 <- Minus
arm_2R 3036920..3037182 1..263 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:45 Download gff for MIP11594.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7150614..7150876 1..263 100   Minus
2R 7150380..7150557 264..441 100 <- Minus

MIP11594.hyp Sequence

Translation from 40 to 333

> MIP11594.hyp
MKKHLEVFLVVALAALAELPGVTASSVEILSHCVACPDEFRGMLVCAFIN
GCYLEIEYCSMVVFNCGRQQHHKHLFLVVNEGKCKPVRGYKCETMDF*

MIP11594.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12828-PA 97 CG12828-PA 1..97 1..97 525 100 Plus

MIP11594.pep Sequence

Translation from 40 to 333

> MIP11594.pep
MKKHLEVFLVVALAALAELPGVTASSVEILSHCVACPDEFRGMLVCAFIN
GCYLEIEYCSMVVFNCGRQQHHKHLFLVVNEGKCKPVRGYKCETMDF*

MIP11594.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10768-PA 97 GG10768-PA 20..97 20..97 350 79.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12828-PA 97 CG12828-PA 1..97 1..97 525 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20816-PA 97 GM20816-PA 1..97 1..97 474 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10272-PA 97 GD10272-PA 1..97 1..97 470 91.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24202-PA 97 GE24202-PA 1..97 1..97 434 82.5 Plus