Clone MIP11624 Report

Search the DGRC for MIP11624

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:116
Well:24
Vector:pOTB7_DraIII
Associated Gene/TranscriptLysE-RA
Protein status:MIP11624.pep: gold
Sequenced Size:607

Clone Sequence Records

MIP11624.complete Sequence

607 bp assembled on 2009-10-08

GenBank Submission: BT099968.1

> MIP11624.complete
AATATGGTGATCACCTTATCACGGTTGAGTACTTATACGTTCTTCTTAAT
AAGGTGATGGTTCAGGGTATATAAGGGCCCATTGCGAGGACCTCTCCATC
AGTTTACTGTGGTATTCAAATCAAAATGAAGGCCTTCATCGTTCTGGTTG
CCCTGGCTATGGCCGCTCCTGCTCTTGGTCGCACCTTGGACCGTTGCTCC
CTGGCCCGCGAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCG
TTGGGCCTGTATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTGG
GTCCTGAGAACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAAC
AACTACTACTGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAACGAGTG
CGGATTGAGCTGCAACGCCCTCTTGACCGACGACATCACCCACTCCGTTC
GTTGCGCCCAGAAGGTCCTTAGCCAGCAGGGATGGTCCGCCTGGTCCACC
TGGCACTACTGCAGCGGATGGTTGCCGTCCATCGATGGCTGCTTCTAAAC
CGATTTCGACCCTGAATAAAAATTTAGCTCAAAAAAAAAAAAAAAAAAAA
AAAAAAA

MIP11624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
LysE-RA 490 LysE-RA 1..490 98..587 2450 100 Plus
LysB-RA 498 LysB-RA 24..469 126..571 2005 96.6 Plus
LysD-RA 480 LysD-RA 20..465 126..571 1870 94.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1212343..1212922 1..580 2825 99.1 Plus
chr3L 24539361 chr3L 1206916..1207361 126..571 2035 97.1 Plus
chr3L 24539361 chr3L 1210238..1210684 571..126 1870 95.1 Minus
chr3L 24539361 chr3L 1227275..1227729 117..571 1020 82.5 Plus
chr3L 24539361 chr3L 1209991..1210232 126..367 865 90.5 Plus
chr3L 24539361 chr3L 1217771..1218120 547..198 670 79.4 Minus
chr3L 24539361 chr3L 1194409..1194776 544..177 610 77.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1212827..1213413 1..587 2935 100 Plus
3L 28110227 3L 1207394..1207839 126..571 2005 96.6 Plus
3L 28110227 3L 1210732..1211177 571..126 1870 94.6 Minus
3L 28110227 3L 1227763..1228217 117..571 1035 82.8 Plus
3L 28110227 3L 1210485..1210726 126..367 850 90.1 Plus
3L 28110227 3L 1218258..1218607 547..198 670 79.4 Minus
3L 28110227 3L 1194874..1195241 544..177 595 77.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1212827..1213413 1..587 2935 100 Plus
3L 28103327 3L 1207394..1207839 126..571 2005 96.6 Plus
3L 28103327 3L 1210732..1211177 571..126 1870 94.6 Minus
3L 28103327 3L 1228023..1228217 377..571 705 90.7 Plus
3L 28103327 3L 1218258..1218607 547..198 670 79.4 Minus
3L 28103327 3L 1210614..1210726 255..367 520 97.3 Plus
3L 28103327 3L 1210485..1210600 126..241 400 89.6 Plus
3L 28103327 3L 1195053..1195241 365..177 390 80.4 Minus
3L 28103327 3L 1227826..1227999 177..350 375 81 Plus
3L 28103327 3L 1194874..1195034 544..384 265 77.6 Minus
Blast to na_te.dros performed on 2019-03-16 07:41:42 has no hits.

MIP11624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:42:27 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1212343..1212922 1..580 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:56 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..423 126..548 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:06 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..423 126..548 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:51 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..423 126..548 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:38 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..423 126..548 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-08 09:35:37 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..483 98..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:05 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:51 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:38 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
LysE-RA 1..580 1..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:27 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1212827..1213406 1..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:27 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1212827..1213406 1..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:27 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1212827..1213406 1..580 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:51 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1212827..1213406 1..580 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:50 Download gff for MIP11624.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1212827..1213406 1..580 100   Plus

MIP11624.pep Sequence

Translation from 125 to 547

> MIP11624.pep
MKAFIVLVALAMAAPALGRTLDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDGCF*

MIP11624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10072-PA 140 GF10072-PA 1..140 1..140 732 96.4 Plus
Dana\GF24436-PA 140 GF24436-PA 1..140 1..140 731 96.4 Plus
Dana\GF10073-PA 140 GF10073-PA 1..140 1..140 619 89.3 Plus
Dana\GF24437-PA 140 GF24437-PA 1..140 1..140 590 85.8 Plus
Dana\GF10070-PA 141 GF10070-PA 1..141 1..140 554 70.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14617-PA 140 GG14617-PA 1..140 1..140 672 93.6 Plus
Dere\GG19822-PA 140 GG19822-PA 1..140 1..140 672 93.6 Plus
Dere\GG14762-PA 140 GG14762-PA 1..140 1..140 672 93.6 Plus
Dere\GG14759-PA 140 GG14759-PA 1..140 1..140 672 93.6 Plus
Dere\GG19823-PA 140 GG19823-PA 1..140 1..140 672 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15486-PA 140 GH15486-PA 1..140 1..140 601 85 Plus
Dgri\GH15485-PA 140 GH15485-PA 1..140 1..140 601 85 Plus
Dgri\GH15987-PA 140 GH15987-PA 1..140 1..140 594 84.3 Plus
Dgri\GH15989-PA 140 GH15989-PA 1..140 1..140 594 84.3 Plus
Dgri\GH15988-PA 143 GH15988-PA 1..143 1..140 505 68.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
LysE-PA 140 CG1180-PA 1..140 1..140 779 100 Plus
LysB-PB 140 CG1179-PB 1..140 1..140 762 97.1 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 762 97.1 Plus
LysD-PA 140 CG9118-PA 1..140 1..140 755 96.4 Plus
LysS-PA 140 CG1165-PA 1..140 1..140 622 81.6 Plus
LysP-PA 141 CG9116-PA 1..141 1..140 601 76.6 Plus
LysX-PA 142 CG9120-PA 1..141 1..140 588 74.5 Plus
CG30062-PB 171 CG30062-PB 23..151 15..140 339 48.1 Plus
CG7798-PA 148 CG7798-PA 7..140 5..140 329 44.5 Plus
CG8492-PD 1360 CG8492-PD 438..552 18..127 229 40.2 Plus
CG8492-PD 1360 CG8492-PD 599..724 22..140 216 36.7 Plus
CG8492-PD 1360 CG8492-PD 6..133 7..129 212 35.9 Plus
CG8492-PD 1360 CG8492-PD 184..297 18..126 195 34.5 Plus
CG11159-PA 146 CG11159-PA 12..146 4..139 191 34.5 Plus
CG16756-PA 152 CG16756-PA 18..137 6..129 176 34.1 Plus
CG16799-PB 179 CG16799-PB 17..145 1..126 161 29.3 Plus
CG16799-PA 179 CG16799-PA 17..145 1..126 161 29.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16762-PA 140 GI16762-PA 1..140 1..140 621 87.9 Plus
Dmoj\GI16761-PA 140 GI16761-PA 1..140 1..140 618 88.6 Plus
Dmoj\GI16643-PA 140 GI16643-PA 1..140 1..140 618 88.6 Plus
Dmoj\GI16642-PA 140 GI16642-PA 1..140 1..140 606 85 Plus
Dmoj\GI16637-PA 140 GI16637-PA 1..140 1..140 599 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16159-PA 140 GL16159-PA 1..140 1..140 647 91.4 Plus
Dper\GL16083-PA 140 GL16083-PA 1..140 1..140 647 91.4 Plus
Dper\GL14512-PA 140 GL14512-PA 1..140 1..140 647 91.4 Plus
Dper\GL16156-PA 140 GL16156-PA 1..140 1..140 630 90.7 Plus
Dper\GL16691-PA 140 GL16691-PA 1..140 1..140 630 90.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28405-PA 140 GA28405-PA 1..140 1..140 702 91.4 Plus
Dpse\GA28406-PA 140 GA28406-PA 1..140 1..140 655 93.6 Plus
Dpse\GA28485-PA 140 GA28485-PA 1..140 1..140 653 92.9 Plus
Dpse\GA28409-PA 140 GA28409-PA 1..140 1..140 647 91.4 Plus
Dpse\GA28483-PA 140 GA28483-PA 1..140 1..140 632 90.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14382-PA 140 GM14382-PA 1..140 1..140 735 97.1 Plus
Dsec\GM14380-PA 140 GM14380-PA 1..140 1..140 675 94.3 Plus
Dsec\GM14229-PA 140 GM14229-PA 1..140 1..140 675 94.3 Plus
Dsec\GM14378-PA 140 GM14378-PA 1..140 1..140 674 93.6 Plus
Dsec\GM14233-PA 149 GM14233-PA 44..130 54..140 377 78.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13594-PA 140 GD13594-PA 1..140 1..140 735 97.1 Plus
Dsim\GD13593-PA 140 GD13593-PA 1..140 1..140 674 93.6 Plus
Dsim\GD17618-PA 140 GD17618-PA 1..140 1..140 599 80.9 Plus
Dsim\GD17617-PA 140 GD17617-PA 1..140 1..140 599 80.9 Plus
Dsim\GD13493-PA 160 GD13493-PA 1..141 1..140 583 75.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12508-PA 140 GJ12508-PA 1..140 1..140 685 90 Plus
Dvir\GJ12507-PA 140 GJ12507-PA 1..140 1..140 685 90 Plus
Dvir\GJ12895-PA 140 GJ12895-PA 1..140 1..140 675 89.3 Plus
Dvir\GJ12893-PA 140 GJ12893-PA 1..140 1..140 658 85.7 Plus
Dvir\GJ12894-PA 143 GJ12894-PA 1..142 1..140 595 78.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21106-PA 141 GK21106-PA 15..141 14..140 641 91.3 Plus
Dwil\GK21095-PA 141 GK21095-PA 15..141 14..140 641 91.3 Plus
Dwil\GK12154-PA 141 GK12154-PA 1..141 1..140 637 87.9 Plus
Dwil\GK21084-PA 141 GK21084-PA 1..141 1..140 637 87.9 Plus
Dwil\GK12260-PA 141 GK12260-PA 1..141 1..140 637 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20977-PA 140 GE20977-PA 1..140 1..140 673 93.6 Plus
Dyak\GE21124-PA 140 GE21124-PA 1..140 1..140 673 93.6 Plus
Dyak\GE21123-PA 140 GE21123-PA 1..140 1..140 672 93.6 Plus
Dyak\GE21125-PA 140 GE21125-PA 1..140 1..140 669 92.9 Plus
Dyak\GE20976-PA 141 GE20976-PA 1..141 1..140 599 78 Plus

MIP11624.hyp Sequence

Translation from 125 to 547

> MIP11624.hyp
MKAFIVLVALAMAAPALGRTLDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDGCF*

MIP11624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
LysE-PA 140 CG1180-PA 1..140 1..140 779 100 Plus
LysB-PB 140 CG1179-PB 1..140 1..140 762 97.1 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 762 97.1 Plus
LysD-PA 140 CG9118-PA 1..140 1..140 755 96.4 Plus
LysC-PA 140 CG9111-PA 1..140 1..140 746 95 Plus