Clone MIP11882 Report

Search the DGRC for MIP11882

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:118
Well:82
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13309-RA
Protein status:MIP11882.pep: gold
Sequenced Size:819

Clone Sequence Records

MIP11882.complete Sequence

819 bp assembled on 2009-10-08

GenBank Submission: BT099975.1

> MIP11882.complete
ACAGTTTCATTCAAAGATGCTGCGCCTACTGATCGTTTTGGGATTTTATA
TCCTGGGCTGCCGAGCAGCCTGCAATACCTGCAACGCTAATGGCGTGTCC
TGTATATCGGAAACGGAGTTTCAGTTCTGCTCCTCCGCCAGCGAACCCAT
CGGAAACCTCTACACCTGCCCCACCGGTTACTACTGCACAGAGAGCACGC
CCATTTGCAGCTCCGTGGCATCTTCGGCAGGTTGTACAGGATGCAATACG
TGCAGTTCGGATAATCGTTTTGCTTGCACCGGTCGGAATACCTTTGCGCT
GTGCCTAGGTACTTCTACACCCAGTACATCGATTGGCGGAAGCTGTGGCA
CTAATTATGTATGCAACGTGGGGAACGCCAATATCTGTGGCAGTCCTGCC
ACATACGCAGTATCCTGTTCCACATCAAGTACGTCAGACTGCGATACTAC
GGCCATCAAAAATGCCACCGAGTATTGTCAAACCATTCAAACAGCCGGAA
AATATCCTTATGGCGGAGATACCTCAACCACCTGCAGGCAATATGTGAAC
TGTTACACCGCTGCTGGTATTTTCTATGGAAATGTGTACACTTGTCCAGG
ACTCACCTACTTCGATAGTACCTCCAAACTTTGCACCACCCAAACGCAGG
CCAGATGCTCGGATACAGTGTCTTGTTTGACTCTCAATAACCGATTATTG
CCGTAGAGTTAAGATTCTAAGGGCCTGAGGTATCTTTATTGTGGTAATTA
TCACAGGGCAAGGGTATCTTAATCAAATAAAGGTAATTCATTAGAAAAAA
AAAAAAAAAAAAAAAAAAA

MIP11882.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13309-RA 851 CG13309-RA 10..807 1..798 3990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8802349..8802888 1..540 2610 98.9 Plus
chr3L 24539361 chr3L 8802959..8803212 541..794 1255 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8810395..8810934 1..540 2700 100 Plus
3L 28110227 3L 8811006..8811263 541..798 1290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8803495..8804034 1..540 2700 100 Plus
3L 28103327 3L 8804106..8804363 541..798 1290 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:58:42 has no hits.

MIP11882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:59:42 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8802349..8802888 1..540 98 -> Plus
chr3L 8802959..8803212 541..794 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:00 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..690 17..706 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:35 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..690 17..706 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:55:53 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..690 17..706 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:30 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..690 17..706 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-08 12:18:34 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..778 17..794 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:35 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:55:53 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:30 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
CG13309-RA 1..794 1..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:59:42 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8810395..8810934 1..540 100 -> Plus
3L 8811006..8811259 541..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:59:42 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8810395..8810934 1..540 100 -> Plus
3L 8811006..8811259 541..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:59:42 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8810395..8810934 1..540 100 -> Plus
3L 8811006..8811259 541..794 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:55:53 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8803495..8804034 1..540 100 -> Plus
arm_3L 8804106..8804359 541..794 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:09 Download gff for MIP11882.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8803495..8804034 1..540 100 -> Plus
3L 8804106..8804359 541..794 100   Plus

MIP11882.hyp Sequence

Translation from 0 to 705

> MIP11882.hyp
QFHSKMLRLLIVLGFYILGCRAACNTCNANGVSCISETEFQFCSSASEPI
GNLYTCPTGYYCTESTPICSSVASSAGCTGCNTCSSDNRFACTGRNTFAL
CLGTSTPSTSIGGSCGTNYVCNVGNANICGSPATYAVSCSTSSTSDCDTT
AIKNATEYCQTIQTAGKYPYGGDTSTTCRQYVNCYTAAGIFYGNVYTCPG
LTYFDSTSKLCTTQTQARCSDTVSCLTLNNRLLP*

MIP11882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13309-PA 229 CG13309-PA 1..229 6..234 1261 100 Plus
CG13308-PB 233 CG13308-PB 1..230 6..228 569 49.1 Plus
CG13312-PA 342 CG13312-PA 15..249 9..224 427 38 Plus
CG13312-PA 342 CG13312-PA 94..341 24..233 285 30.3 Plus
CG32024-PA 209 CG32024-PA 5..209 6..220 277 29.8 Plus
CG14958-PA 145 CG14958-PA 3..136 5..134 250 37 Plus

MIP11882.pep Sequence

Translation from 1 to 705

> MIP11882.pep
QFHSKMLRLLIVLGFYILGCRAACNTCNANGVSCISETEFQFCSSASEPI
GNLYTCPTGYYCTESTPICSSVASSAGCTGCNTCSSDNRFACTGRNTFAL
CLGTSTPSTSIGGSCGTNYVCNVGNANICGSPATYAVSCSTSSTSDCDTT
AIKNATEYCQTIQTAGKYPYGGDTSTTCRQYVNCYTAAGIFYGNVYTCPG
LTYFDSTSKLCTTQTQARCSDTVSCLTLNNRLLP*

MIP11882.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24359-PA 230 GF24359-PA 1..230 6..234 710 64.8 Plus
Dana\GF24358-PA 233 GF24358-PA 16..230 15..228 490 50.2 Plus
Dana\GF10144-PA 335 GF10144-PA 4..229 4..211 318 38.8 Plus
Dana\GF20076-PA 169 GF20076-PA 1..166 6..175 218 35 Plus
Dana\GF10121-PA 147 GF10121-PA 9..138 9..134 191 35.9 Plus
Dana\GF10144-PA 335 GF10144-PA 255..334 154..233 184 47.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14353-PA 229 GG14353-PA 1..229 6..234 1017 87.8 Plus
Dere\GG14351-PA 230 GG14351-PA 4..227 6..228 515 49.3 Plus
Dere\GG15055-PA 344 GG15055-PA 27..240 19..213 304 38.1 Plus
Dere\GG14350-PA 209 GG14350-PA 1..209 2..220 258 33.8 Plus
Dere\GG15055-PA 344 GG15055-PA 264..343 154..233 198 48.8 Plus
Dere\GG15111-PA 148 GG15111-PA 16..139 15..134 182 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15330-PA 234 GH15330-PA 17..234 19..233 400 40 Plus
Dgri\GH16136-PA 333 GH16136-PA 23..235 21..219 337 38.8 Plus
Dgri\GH10924-PA 155 GH10924-PA 2..139 4..134 190 33.8 Plus
Dgri\GH16136-PA 333 GH16136-PA 253..332 154..233 169 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13309-PA 229 CG13309-PA 1..229 6..234 1261 100 Plus
CG13308-PB 233 CG13308-PB 1..230 6..228 569 49.1 Plus
CG13312-PA 342 CG13312-PA 15..249 9..224 427 38 Plus
CG13312-PA 342 CG13312-PA 94..341 24..233 285 30.3 Plus
CG32024-PA 209 CG32024-PA 5..209 6..220 277 29.8 Plus
CG14958-PA 145 CG14958-PA 3..136 5..134 250 37 Plus
CG34427-PB 269 CG34427-PB 13..268 9..219 208 25.6 Plus
CG13311-PA 153 CG13311-PA 10..148 7..148 203 32.2 Plus
CG13075-PB 339 CG13075-PB 22..256 23..224 202 25.8 Plus
CG34426-PA 296 CG34426-PA 17..296 22..223 185 26.1 Plus
CG33258-PC 252 CG33258-PC 1..252 6..220 172 26.4 Plus
CG33258-PB 252 CG33258-PB 1..252 6..220 172 26.4 Plus
CG32023-PA 160 CG32023-PA 3..137 3..129 157 30.6 Plus
CG42494-PC 283 CG42494-PC 6..195 11..226 149 25.2 Plus
CG42494-PB 283 CG42494-PB 6..195 11..226 149 25.2 Plus
CG42494-PA 283 CG42494-PA 6..195 11..226 149 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12935-PA 216 GI12935-PA 16..211 20..219 383 43.3 Plus
Dmoj\GI12405-PA 343 GI12405-PA 7..245 5..219 310 36.2 Plus
Dmoj\GI12932-PA 230 GI12932-PA 1..224 6..218 247 32.6 Plus
Dmoj\GI13368-PA 149 GI13368-PA 7..140 6..134 192 34.8 Plus
Dmoj\GI12405-PA 343 GI12405-PA 263..338 154..229 157 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10346-PA 231 GL10346-PA 15..231 20..234 577 53.9 Plus
Dper\GL10345-PA 237 GL10345-PA 1..236 6..233 442 47.1 Plus
Dper\GL24894-PA 143 GL24894-PA 5..124 11..129 170 36.3 Plus
Dper\GL10344-PA 166 GL10344-PA 1..74 6..78 158 44.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12189-PA 231 GA12189-PA 15..231 20..234 581 53.9 Plus
Dpse\GA12188-PA 237 GA12188-PA 1..236 6..233 445 47.1 Plus
Dpse\GA12193-PA 330 GA12193-PA 7..224 16..211 328 40.6 Plus
Dpse\GA12193-PA 330 GA12193-PA 250..329 154..233 185 45 Plus
Dpse\GA13383-PA 150 GA13383-PA 20..131 22..129 164 36.3 Plus
Dpse\GA28199-PA 168 GA28199-PA 1..74 6..78 158 44.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25097-PA 229 GM25097-PA 1..229 6..234 1066 93.4 Plus
Dsec\GM24912-PA 342 GM24912-PA 27..238 21..213 296 39.3 Plus
Dsec\GM25096-PA 118 GM25096-PA 1..117 6..116 266 53.4 Plus
Dsec\GM24912-PA 342 GM24912-PA 262..341 154..233 208 50 Plus
Dsec\GM14547-PA 145 GM14547-PA 3..136 5..134 205 38.5 Plus
Dsec\GM25095-PA 168 GM25095-PA 1..165 6..175 181 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14131-PA 229 GD14131-PA 1..229 6..234 1072 93.9 Plus
Dsim\GD14130-PA 225 GD14130-PA 1..225 6..218 461 49.8 Plus
Dsim\GD12959-PA 342 GD12959-PA 27..238 21..213 303 39 Plus
Dsim\GD12959-PA 342 GD12959-PA 262..341 154..233 201 48.8 Plus
Dsim\GD13738-PA 145 GD13738-PA 3..136 5..134 201 37 Plus
Dsim\GD14129-PA 168 GD14129-PA 1..165 6..175 176 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13076-PA 239 GJ13076-PA 14..224 17..224 411 43.7 Plus
Dvir\GJ12295-PA 362 GJ12295-PA 5..264 3..219 315 34.1 Plus
Dvir\GJ13075-PA 245 GJ13075-PA 3..232 5..211 247 31.8 Plus
Dvir\GJ12008-PA 149 GJ12008-PA 8..140 7..134 195 37.3 Plus
Dvir\GJ12295-PA 362 GJ12295-PA 282..357 154..229 173 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16742-PA 234 GK16742-PA 14..223 17..223 480 49 Plus
Dwil\GK17466-PA 337 GK17466-PA 2..240 6..220 367 40.4 Plus
Dwil\GK17466-PA 337 GK17466-PA 258..337 154..233 184 47.5 Plus
Dwil\GK13204-PA 148 GK13204-PA 7..139 7..134 182 38.1 Plus
Dwil\GK17468-PA 151 GK17468-PA 8..135 5..129 138 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20785-PA 229 GE20785-PA 14..229 19..234 957 88.9 Plus
Dyak\GE20784-PA 232 GE20784-PA 12..231 11..230 459 48.6 Plus
Dyak\GE21279-PA 345 GE21279-PA 30..241 21..213 295 37.6 Plus
Dyak\GE20783-PA 209 GE20783-PA 4..209 5..220 233 32.3 Plus
Dyak\GE21279-PA 345 GE21279-PA 265..344 154..233 195 47.5 Plus
Dyak\GE21338-PA 148 GE21338-PA 22..139 21..134 175 37.8 Plus