Clone MIP12466 Report

Search the DGRC for MIP12466

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:124
Well:66
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG43107-RA
Protein status:MIP12466.pep: gold
Sequenced Size:418

Clone Sequence Records

MIP12466.complete Sequence

418 bp assembled on 2009-10-23

GenBank Submission: BT100158.1

> MIP12466.complete
ATTTATTTACGTGCAATCAGTTGATTCTTGCTTGCCGCCAGTTTAGAGTG
TTTTTGTTATGAACAGTTCCAAAAACGATGTCCGTTCTTCCTTTAAATAC
GGGCCAGCTGTCCGGATCGGAATCGCCGTCCTGGTGCTCCACACCGTCGG
CTGGCTGGGTTGGAAGGCGGTGAACCAGGGTGCGGAATCCAAGGAGGCAG
CAGCGAAGGCCCAGCAAGAACAATTGCGAGCGGTATTCGCAGAAAAGTGA
TATAACTATGGATGATAACACCATACTGGTTAGCAAACCACCACGGACTG
AGTGCATTTTAGATAGTTATTGTTAGAACCCTAGACAACTAAGTGTATTA
AAAGAAATAAAAGGAATTGTTTGCTTGTTTGTTTTACAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

MIP12466.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 16:55:50 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13027686..13028059 386..1 1715 96.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17140494..17140879 386..1 1930 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17141693..17142078 386..1 1930 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:09:48 has no hits.

MIP12466.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:10:31 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13027685..13028059 1..387 96   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:29 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..192 59..250 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..192 59..250 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:06 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..192 59..250 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:29 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..385 1..385 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..385 1..385 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:06 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 1..371 15..385 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140493..17140879 1..387 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140493..17140879 1..387 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140493..17140879 1..387 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:11 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13027998..13028384 1..387 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:31 Download gff for MIP12466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17141692..17142078 1..387 99   Minus

MIP12466.pep Sequence

Translation from 58 to 249

> MIP12466.pep
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEK*

MIP12466.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13418-PA 65 GF13418-PA 1..65 1..63 230 72.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-PA 63 CG43107-PA 1..63 1..63 317 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17258-PA 65 GL17258-PA 1..65 1..63 158 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24152-PA 65 GA24152-PA 1..65 1..63 158 56.9 Plus
Dpse\GA22238-PA 65 GA22238-PA 1..65 1..63 158 56.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19999-PA 135 GM19999-PA 76..135 4..63 301 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25490-PA 57 GD25490-PA 4..57 10..63 268 98.1 Plus

MIP12466.hyp Sequence

Translation from 58 to 249

> MIP12466.hyp
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEK*

MIP12466.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-PA 63 CG43107-PA 1..63 1..63 317 100 Plus