MIP12466.complete Sequence
418 bp assembled on 2009-10-23
GenBank Submission: BT100158.1
> MIP12466.complete
ATTTATTTACGTGCAATCAGTTGATTCTTGCTTGCCGCCAGTTTAGAGTG
TTTTTGTTATGAACAGTTCCAAAAACGATGTCCGTTCTTCCTTTAAATAC
GGGCCAGCTGTCCGGATCGGAATCGCCGTCCTGGTGCTCCACACCGTCGG
CTGGCTGGGTTGGAAGGCGGTGAACCAGGGTGCGGAATCCAAGGAGGCAG
CAGCGAAGGCCCAGCAAGAACAATTGCGAGCGGTATTCGCAGAAAAGTGA
TATAACTATGGATGATAACACCATACTGGTTAGCAAACCACCACGGACTG
AGTGCATTTTAGATAGTTATTGTTAGAACCCTAGACAACTAAGTGTATTA
AAAGAAATAAAAGGAATTGTTTGCTTGTTTGTTTTACAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
MIP12466.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 16:55:50 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:09:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 13027686..13028059 | 386..1 | 1715 | 96.9 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:09:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17140494..17140879 | 386..1 | 1930 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 17141693..17142078 | 386..1 | 1930 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 17:09:48 has no hits.
MIP12466.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:10:31 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 13027685..13028059 | 1..387 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:29 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..192 | 59..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..192 | 59..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:06 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..192 | 59..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:29 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..385 | 1..385 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..385 | 1..385 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:06 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43107-RA | 1..371 | 15..385 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17140493..17140879 | 1..387 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17140493..17140879 | 1..387 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:31 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17140493..17140879 | 1..387 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:11 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13027998..13028384 | 1..387 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:31 Download gff for
MIP12466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17141692..17142078 | 1..387 | 99 | | Minus |
MIP12466.pep Sequence
Translation from 58 to 249
> MIP12466.pep
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEK*
MIP12466.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:44:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13418-PA | 65 | GF13418-PA | 1..65 | 1..63 | 230 | 72.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43107-PA | 63 | CG43107-PA | 1..63 | 1..63 | 317 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL17258-PA | 65 | GL17258-PA | 1..65 | 1..63 | 158 | 56.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24152-PA | 65 | GA24152-PA | 1..65 | 1..63 | 158 | 56.9 | Plus |
Dpse\GA22238-PA | 65 | GA22238-PA | 1..65 | 1..63 | 158 | 56.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19999-PA | 135 | GM19999-PA | 76..135 | 4..63 | 301 | 96.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25490-PA | 57 | GD25490-PA | 4..57 | 10..63 | 268 | 98.1 | Plus |
MIP12466.hyp Sequence
Translation from 58 to 249
> MIP12466.hyp
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEK*
MIP12466.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43107-PA | 63 | CG43107-PA | 1..63 | 1..63 | 317 | 100 | Plus |