MIP12787.complete Sequence
367 bp assembled on 2009-07-13
GenBank Submission: BT099954.1
> MIP12787.complete
ATCAGTTGCACTTAAGTTTGAACTAACAATCTATCGAATTGAACGGAAAT
CGAGATGCGCCCAACACTCCAGGTCCTCATCAGTGTCCTTTGTCTGGTCT
CTGCCTACGCCTGGGATCATACCGACTGTAACGATCACTATATCGAATTC
ATGGACTATCCCGATGAGAGAGCTACCGCCTATAGCAATGAATCCTCAGA
ATGGGATTTCTTTGAATTTTGGAGGCAAGTGTTTGGCCTGTAGCAATTCT
GACATCGCTGACCACGCCTCTGGTCAAAGCAATCACTTGGCGAGACATGT
GACCCTCGGATGTCAGGGCGTGAATAAAGAACATTAAAATCAAAAAAAAA
AAAAAAAAAAAAAAAAA
MIP12787.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 16:22:20 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:43:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr2R | 21145070 | chr2R | 7137057..7137396 | 1..340 | 1700 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 11249594..11249933 | 1..340 | 1700 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:07:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25260384 | 2R | 11250793..11251132 | 1..340 | 1700 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 15:43:42 has no hits.
MIP12787.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:44:52 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr2R | 7137057..7137396 | 1..341 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:56 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..189 | 55..243 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:17:19 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..189 | 55..243 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:10 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..189 | 55..243 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:56 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..340 | 1..340 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:17:19 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..340 | 1..340 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:10 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43112-RA | 1..340 | 1..340 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:52 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11249594..11249933 | 1..341 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:52 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11249594..11249933 | 1..341 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:52 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11249594..11249933 | 1..341 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:17:19 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 7137099..7137438 | 1..341 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:31:42 Download gff for
MIP12787.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11250793..11251132 | 1..341 | 99 | | Plus |
MIP12787.hyp Sequence
Translation from 0 to 336
> MIP12787.hyp
SVALKFELTIYRIERKSRCAQHSRSSSVSFVWSLPTPGIIPTVTITISNS
WTIPMRELPPIAMNPQNGISLNFGGKCLACSNSDIADHASGQSNHLARHV
TLGCQGVNKEH*
Sequence MIP12787.hyp has no blast hits.
MIP12787.pep Sequence
Translation from 54 to 242
> MIP12787.pep
MRPTLQVLISVLCLVSAYAWDHTDCNDHYIEFMDYPDERATAYSNESSEW
DFFEFWRQVFGL*
MIP12787.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:49:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG20178-PA | 62 | GG20178-PA | 1..61 | 1..61 | 204 | 63.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43112-PA | 62 | CG43112-PA | 1..62 | 1..62 | 348 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:49:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM21267-PA | 62 | GM21267-PA | 1..62 | 1..62 | 250 | 88.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:49:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD10780-PA | 62 | GD10780-PA | 1..62 | 1..62 | 296 | 85.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:49:16
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE12867-PA | 62 | GE12867-PA | 1..60 | 1..60 | 215 | 68.3 | Plus |
