Clone MIP13505 Report

Search the DGRC for MIP13505

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:135
Well:5
Vector:pOT2
Associated Gene/TranscriptCG11563-RA
Protein status:MIP13505.pep: gold
Sequenced Size:858

Clone Sequence Records

MIP13505.complete Sequence

858 bp assembled on 2011-07-20

GenBank Submission: BT128769.1

> MIP13505.complete
GCAACACGTGCGGTTTTAAAATTGTTTTGGTCCCCTCAATTGATTTTAAA
CATTGTTTGATTCATTAATTAAACCTCTCAACAATGAAGATCCGCAAGAA
TCATGCTCGCAAGCGTTATCGCTACAATGTAAACCGCAAGACGATGAATA
AAACCCGGAGTTCCACCGGAAAAATTAAGGATCCCAGGATGAAAAAGATG
TGGATGGAGGACCAGCGTGTGGGCACCAACTTCAGTGAAATGGGGTTGGC
CAAGGACGTCAACAAGGCCATTGCGATTCCCAGCTACAAGAAGGACCGCC
TCCTAGCGGCCCGAGTTGTGAATGGGTTTCTGGAGGAGGAGCTGGACGAG
GATGAGCGGCGTGTATTGGGCCTCAAGAAACCAGTCGTAGAGGAGGGTCC
AAAACGTGGACACGTAGTCCAGGAACTAGAACAACTGGCTAGCGAGCGAG
CCGACCCAGAGTTCAGATTACCCAAGGGCGTGGTCAAGGAACTGTCCTAC
TTTCTTAACAAACATAAGTTTAACTACAAGGCGATGGTTGCCGATCGGAA
AAACTTTGGCCAGTGGACGTGGCGGCAGTTCCGCTTGAAGATTCGCAGAT
TTATGTCGATTCCGGAGCAGTTTAACGTTTACCTGGAGCAGAAGAAGTTG
CCCGTGGGCGTGAAACCGGACTGGGAGGAATACGAGTCGGACAGTGAATG
GAAATAATGGCTCTTGACCAATGTACATTATAGTCGTTTTCGGGTTCTAA
TGCTATTAATTGTAATGTTTAGACTTACTTTAATTCTTTTAATACAATAA
AATAGGCAAGTAAAGACGAACGCAAAAGGTCTACGTAAAAAAAAAAAAAA
AAAAAAAA

MIP13505.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27560007..27560379 464..836 1865 100 Plus
chr3R 27901430 chr3R 27559667..27559951 182..466 1425 100 Plus
chr3R 27901430 chr3R 27559410..27559590 1..181 905 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31737656..31738029 464..837 1870 100 Plus
3R 32079331 3R 31737316..31737600 182..466 1425 100 Plus
3R 32079331 3R 31737059..31737239 1..181 905 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31478487..31478860 464..837 1870 100 Plus
3R 31820162 3R 31478147..31478431 182..466 1425 100 Plus
3R 31820162 3R 31477890..31478070 1..181 905 100 Plus
Blast to na_te.dros performed on 2019-03-15 10:47:20 has no hits.

MIP13505.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:48:12 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27559410..27559590 1..181 100 -> Plus
chr3R 27559667..27559951 182..466 100 -> Plus
chr3R 27560010..27560379 467..836 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-20 17:15:03 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 1..624 84..707 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:25:35 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 1..624 84..707 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:12:18 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 1..624 84..707 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-20 17:15:02 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 35..841 1..807 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:25:35 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 25..831 1..807 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:18 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
CG11563-RA 25..831 1..807 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:12 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31737059..31737239 1..181 100 -> Plus
3R 31737316..31737600 182..466 100 -> Plus
3R 31737659..31738028 467..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:12 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31737059..31737239 1..181 100 -> Plus
3R 31737316..31737600 182..466 100 -> Plus
3R 31737659..31738028 467..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:12 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31737059..31737239 1..181 100 -> Plus
3R 31737316..31737600 182..466 100 -> Plus
3R 31737659..31738028 467..836 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:25:35 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27562781..27562961 1..181 100 -> Plus
arm_3R 27563038..27563322 182..466 100 -> Plus
arm_3R 27563381..27563750 467..836 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:16 Download gff for MIP13505.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31478147..31478431 182..466 100 -> Plus
3R 31478490..31478859 467..836 100   Plus
3R 31477890..31478070 1..181 100 -> Plus

MIP13505.pep Sequence

Translation from 83 to 706

> MIP13505.pep
MKIRKNHARKRYRYNVNRKTMNKTRSSTGKIKDPRMKKMWMEDQRVGTNF
SEMGLAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKP
VVEEGPKRGHVVQELEQLASERADPEFRLPKGVVKELSYFLNKHKFNYKA
MVADRKNFGQWTWRQFRLKIRRFMSIPEQFNVYLEQKKLPVGVKPDWEEY
ESDSEWK*

MIP13505.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22981-PA 207 GF22981-PA 1..207 1..207 899 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11825-PA 207 GG11825-PA 1..207 1..207 1059 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18650-PA 206 GH18650-PA 1..206 1..207 764 69.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG11563-PA 207 CG11563-PA 1..207 1..207 1090 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23128-PA 209 GI23128-PA 1..209 1..207 861 78 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23994-PA 207 GL23994-PA 1..207 1..207 869 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11068-PA 207 GA11068-PA 1..207 1..207 869 84.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16445-PA 207 GM16445-PA 1..207 1..207 1089 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21597-PA 207 GD21597-PA 1..207 1..207 1089 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23102-PA 209 GJ23102-PA 1..209 1..207 859 78.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12115-PA 207 GK12115-PA 1..207 1..207 875 78.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10958-PA 207 GE10958-PA 1..207 1..207 1068 98.1 Plus

MIP13505.hyp Sequence

Translation from 83 to 706

> MIP13505.hyp
MKIRKNHARKRYRYNVNRKTMNKTRSSTGKIKDPRMKKMWMEDQRVGTNF
SEMGLAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKP
VVEEGPKRGHVVQELEQLASERADPEFRLPKGVVKELSYFLNKHKFNYKA
MVADRKNFGQWTWRQFRLKIRRFMSIPEQFNVYLEQKKLPVGVKPDWEEY
ESDSEWK*

MIP13505.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11563-PA 207 CG11563-PA 1..207 1..207 1090 100 Plus