BDGP Sequence Production Resources |
Search the DGRC for MIP13505
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 135 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11563-RA |
Protein status: | MIP13505.pep: gold |
Sequenced Size: | 858 |
858 bp assembled on 2011-07-20
GenBank Submission: BT128769.1
> MIP13505.complete GCAACACGTGCGGTTTTAAAATTGTTTTGGTCCCCTCAATTGATTTTAAA CATTGTTTGATTCATTAATTAAACCTCTCAACAATGAAGATCCGCAAGAA TCATGCTCGCAAGCGTTATCGCTACAATGTAAACCGCAAGACGATGAATA AAACCCGGAGTTCCACCGGAAAAATTAAGGATCCCAGGATGAAAAAGATG TGGATGGAGGACCAGCGTGTGGGCACCAACTTCAGTGAAATGGGGTTGGC CAAGGACGTCAACAAGGCCATTGCGATTCCCAGCTACAAGAAGGACCGCC TCCTAGCGGCCCGAGTTGTGAATGGGTTTCTGGAGGAGGAGCTGGACGAG GATGAGCGGCGTGTATTGGGCCTCAAGAAACCAGTCGTAGAGGAGGGTCC AAAACGTGGACACGTAGTCCAGGAACTAGAACAACTGGCTAGCGAGCGAG CCGACCCAGAGTTCAGATTACCCAAGGGCGTGGTCAAGGAACTGTCCTAC TTTCTTAACAAACATAAGTTTAACTACAAGGCGATGGTTGCCGATCGGAA AAACTTTGGCCAGTGGACGTGGCGGCAGTTCCGCTTGAAGATTCGCAGAT TTATGTCGATTCCGGAGCAGTTTAACGTTTACCTGGAGCAGAAGAAGTTG CCCGTGGGCGTGAAACCGGACTGGGAGGAATACGAGTCGGACAGTGAATG GAAATAATGGCTCTTGACCAATGTACATTATAGTCGTTTTCGGGTTCTAA TGCTATTAATTGTAATGTTTAGACTTACTTTAATTCTTTTAATACAATAA AATAGGCAAGTAAAGACGAACGCAAAAGGTCTACGTAAAAAAAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 27560007..27560379 | 464..836 | 1865 | 100 | Plus |
chr3R | 27901430 | chr3R | 27559667..27559951 | 182..466 | 1425 | 100 | Plus |
chr3R | 27901430 | chr3R | 27559410..27559590 | 1..181 | 905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 31737656..31738029 | 464..837 | 1870 | 100 | Plus |
3R | 32079331 | 3R | 31737316..31737600 | 182..466 | 1425 | 100 | Plus |
3R | 32079331 | 3R | 31737059..31737239 | 1..181 | 905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 31478487..31478860 | 464..837 | 1870 | 100 | Plus |
3R | 31820162 | 3R | 31478147..31478431 | 182..466 | 1425 | 100 | Plus |
3R | 31820162 | 3R | 31477890..31478070 | 1..181 | 905 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 27559410..27559590 | 1..181 | 100 | -> | Plus |
chr3R | 27559667..27559951 | 182..466 | 100 | -> | Plus |
chr3R | 27560010..27560379 | 467..836 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 1..624 | 84..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 1..624 | 84..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 1..624 | 84..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 35..841 | 1..807 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 25..831 | 1..807 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11563-RA | 25..831 | 1..807 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 31737059..31737239 | 1..181 | 100 | -> | Plus |
3R | 31737316..31737600 | 182..466 | 100 | -> | Plus |
3R | 31737659..31738028 | 467..836 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 31737059..31737239 | 1..181 | 100 | -> | Plus |
3R | 31737316..31737600 | 182..466 | 100 | -> | Plus |
3R | 31737659..31738028 | 467..836 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 31737059..31737239 | 1..181 | 100 | -> | Plus |
3R | 31737316..31737600 | 182..466 | 100 | -> | Plus |
3R | 31737659..31738028 | 467..836 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 27562781..27562961 | 1..181 | 100 | -> | Plus |
arm_3R | 27563038..27563322 | 182..466 | 100 | -> | Plus |
arm_3R | 27563381..27563750 | 467..836 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 31478147..31478431 | 182..466 | 100 | -> | Plus |
3R | 31478490..31478859 | 467..836 | 100 | Plus | |
3R | 31477890..31478070 | 1..181 | 100 | -> | Plus |
Translation from 83 to 706
> MIP13505.pep MKIRKNHARKRYRYNVNRKTMNKTRSSTGKIKDPRMKKMWMEDQRVGTNF SEMGLAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKP VVEEGPKRGHVVQELEQLASERADPEFRLPKGVVKELSYFLNKHKFNYKA MVADRKNFGQWTWRQFRLKIRRFMSIPEQFNVYLEQKKLPVGVKPDWEEY ESDSEWK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22981-PA | 207 | GF22981-PA | 1..207 | 1..207 | 899 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11825-PA | 207 | GG11825-PA | 1..207 | 1..207 | 1059 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18650-PA | 206 | GH18650-PA | 1..206 | 1..207 | 764 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11563-PA | 207 | CG11563-PA | 1..207 | 1..207 | 1090 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23128-PA | 209 | GI23128-PA | 1..209 | 1..207 | 861 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23994-PA | 207 | GL23994-PA | 1..207 | 1..207 | 869 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11068-PA | 207 | GA11068-PA | 1..207 | 1..207 | 869 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16445-PA | 207 | GM16445-PA | 1..207 | 1..207 | 1089 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21597-PA | 207 | GD21597-PA | 1..207 | 1..207 | 1089 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23102-PA | 209 | GJ23102-PA | 1..209 | 1..207 | 859 | 78.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12115-PA | 207 | GK12115-PA | 1..207 | 1..207 | 875 | 78.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10958-PA | 207 | GE10958-PA | 1..207 | 1..207 | 1068 | 98.1 | Plus |
Translation from 83 to 706
> MIP13505.hyp MKIRKNHARKRYRYNVNRKTMNKTRSSTGKIKDPRMKKMWMEDQRVGTNF SEMGLAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKP VVEEGPKRGHVVQELEQLASERADPEFRLPKGVVKELSYFLNKHKFNYKA MVADRKNFGQWTWRQFRLKIRRFMSIPEQFNVYLEQKKLPVGVKPDWEEY ESDSEWK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11563-PA | 207 | CG11563-PA | 1..207 | 1..207 | 1090 | 100 | Plus |