Clone MIP13629 Report

Search the DGRC for MIP13629

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:136
Well:29
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13069-RA
Protein status:MIP13629.pep: gold
Sequenced Size:410

Clone Sequence Records

MIP13629.complete Sequence

410 bp assembled on 2009-09-28

GenBank Submission: BT099859.1

> MIP13629.complete
AAACAGCCAAATCCACCAAGATGTTCAAGTTCTTCGCCGTCGCCCTCTTC
GCACTGATTGCCTGCGTGGCCGCCAAGCCCGGAATCGTGGCTCCTCTGGC
CTACTCCGCACCTCTGGTGGCTGCTGCTCCGGCGGCTGCGGTTTACAGCC
GGGAATACCACGGAAATTTTGCGGCTCCCTACGTGGCATCTCCCTATGTG
GCTTCTCCCTACGTGGCTTCTCCCTACGTCGCTTCCCCTTACGTGGCGTC
TCCGTATGTGGCATCTCCCTACGTTGCCGCCCCCTACACCGCTCCTCTGC
TGCTGAAGAAGTAGGATGAGTGATCCAGGCTTTAACGAAATCTAAGGACA
ACTCAAACCGAAATAAACGAAATAATAAAAGTATTATAAAAATCGAAAAA
AAAAAAAAAA

MIP13629.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-RA 378 CG13069-RA 20..378 1..359 1795 100 Plus
CG13051-RA 252 CG13051-RA 1..89 21..109 355 93.2 Plus
CG13051-RA 252 CG13051-RA 91..156 177..242 210 87.8 Plus
CG13051-RA 252 CG13051-RA 91..162 222..293 195 84.7 Plus
CG13051-RA 252 CG13051-RA 89..141 235..287 190 90.5 Plus
CG13051-RA 252 CG13051-RA 100..156 171..227 165 85.9 Plus
CG13051-RA 252 CG13051-RA 91..146 192..247 160 85.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16255109..16255503 1..395 1870 98.2 Plus
chr3L 24539361 chr3L 16254663..16254765 109..7 395 92.2 Minus
chr3L 24539361 chr3L 16254596..16254661 242..177 210 87.9 Minus
chr3L 24539361 chr3L 16254590..16254661 293..222 195 84.7 Minus
chr3L 24539361 chr3L 16254611..16254663 287..235 190 90.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16265410..16265807 1..398 1990 100 Plus
3L 28110227 3L 16264977..16265079 109..7 395 92.2 Minus
3L 28110227 3L 16264910..16264975 242..177 210 87.9 Minus
3L 28110227 3L 16264904..16264975 293..222 195 84.7 Minus
3L 28110227 3L 16264925..16264977 287..235 190 90.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16258510..16258907 1..398 1990 100 Plus
3L 28103327 3L 16258077..16258179 109..7 395 92.2 Minus
3L 28103327 3L 16258010..16258075 242..177 210 87.8 Minus
3L 28103327 3L 16258004..16258075 293..222 195 84.7 Minus
3L 28103327 3L 16258025..16258077 287..235 190 90.5 Minus
3L 28103327 3L 16258010..16258066 227..171 165 85.9 Minus
3L 28103327 3L 16258020..16258075 247..192 160 85.7 Minus
Blast to na_te.dros performed on 2019-03-16 07:32:28 has no hits.

MIP13629.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:33:15 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16255109..16255503 1..395 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:31 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 1..294 21..314 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:24 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 1..294 21..314 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:29 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 1..294 21..314 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:35 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 1..294 21..314 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:00 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 20..378 1..359 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:24 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 26..420 1..395 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:29 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 26..420 1..395 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:35 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 26..420 1..395 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:15 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16265410..16265804 1..395 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:15 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16265410..16265804 1..395 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:15 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16265410..16265804 1..395 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:29 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16258510..16258904 1..395 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:41 Download gff for MIP13629.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16258510..16258904 1..395 100   Plus

MIP13629.hyp Sequence

Translation from 0 to 318

> MIP13629.hyp
NSQIHQDVQVLRRRPLRTDCLRGRQARNRGSSGLLRTSGGCCSGGCGLQP
GIPRKFCGSLRGISLCGFSLRGFSLRRFPLRGVSVCGISLRCRPLHRSSA
AEEVG*
Sequence MIP13629.hyp has no blast hits.

MIP13629.pep Sequence

Translation from 2 to 313

> MIP13629.pep
TAKSTKMFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSR
EYHGNFAAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPLL
LKK*

MIP13629.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24169-PA 92 GF24169-PA 1..92 7..103 367 89.8 Plus
Dana\GF10308-PA 82 GF10308-PA 1..53 7..81 181 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15971-PA 92 GG15971-PA 1..92 7..103 395 92.8 Plus
Dere\GG13482-PA 83 GG13482-PA 1..48 7..76 158 60 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15619-PA 86 GH15619-PA 1..86 7..103 323 77.3 Plus
Dgri\GH15866-PA 79 GH15866-PA 1..60 7..91 196 57.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-PA 97 CG13069-PA 1..97 7..103 493 100 Plus
CG13051-PA 83 CG13051-PA 1..83 7..103 243 56.2 Plus
CG13067-PA 79 CG13067-PA 1..76 7..82 175 55 Plus
CG18294-PA 141 CG18294-PA 1..111 7..102 172 45.3 Plus
CG12519-PB 131 CG12519-PB 1..108 7..99 166 45.6 Plus
CG12519-PA 131 CG12519-PA 1..108 7..99 166 45.6 Plus
CG13678-PA 128 CG13678-PA 1..128 7..103 165 42.4 Plus
CG32214-PC 116 CG32214-PC 1..105 7..99 163 45.5 Plus
CG32214-PB 116 CG32214-PB 1..105 7..99 163 45.5 Plus
825-Oak-PB 129 CG32208-PB 1..102 7..99 161 46.3 Plus
CG32213-PB 129 CG32213-PB 1..102 7..99 158 45.4 Plus
CG14096-PA 122 CG14096-PA 1..112 7..102 156 43.2 Plus
CG13674-PB 137 CG13674-PB 2..103 9..99 156 45.2 Plus
CG13674-PA 137 CG13674-PA 2..103 9..99 156 45.2 Plus
CG13047-PB 170 CG13047-PB 1..151 7..98 151 36.8 Plus
CG13679-PB 119 CG13679-PB 2..119 9..103 146 44.2 Plus
CG13068-PA 109 CG13068-PA 1..103 7..97 142 43.9 Plus
CG32266-PA 77 CG32266-PA 1..70 7..85 135 40.5 Plus
CG13066-PB 93 CG13066-PB 1..86 7..89 134 48.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12646-PA 79 GI12646-PA 1..79 7..103 231 62.4 Plus
Dmoj\GI12667-PA 84 GI12667-PA 1..84 7..103 221 60.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25191-PA 99 GL25191-PA 1..99 7..103 369 84.8 Plus
Dper\GL20709-PA 104 GL20709-PA 1..104 7..103 329 85.6 Plus
Dper\GL20833-PA 109 GL20833-PA 1..109 7..103 324 81.7 Plus
Dper\GL20708-PA 102 GL20708-PA 1..62 7..78 191 69.4 Plus
Dper\GL20832-PA 102 GL20832-PA 1..62 7..78 191 69.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23721-PA 99 GA23721-PA 1..99 7..103 367 83.8 Plus
Dpse\GA28291-PA 109 GA28291-PA 1..109 7..103 324 81.7 Plus
Dpse\GA28572-PA 101 GA28572-PA 1..61 7..83 199 67.5 Plus
Dpse\GA28290-PA 102 GA28290-PA 1..62 7..78 191 69.4 Plus
Dpse\GA23571-PA 102 GA23571-PA 1..62 7..78 187 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25605-PA 97 GM25605-PA 1..97 7..103 440 100 Plus
Dsec\GM24432-PA 88 GM24432-PA 1..53 7..81 180 62.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12645-PA 87 GJ12645-PA 1..87 7..103 284 80.4 Plus
Dvir\GJ12768-PA 82 GJ12768-PA 1..65 7..86 133 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19294-PA 89 GK19294-PA 1..89 7..103 145 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22574-PA 88 GE22574-PA 1..64 7..98 200 60.9 Plus