Clone MIP13653 Report

Search the DGRC for MIP13653

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:136
Well:53
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14752-RA
Protein status:MIP13653.pep: gold
Sequenced Size:568

Clone Sequence Records

MIP13653.complete Sequence

568 bp assembled on 2009-09-28

GenBank Submission: BT099846.1

> MIP13653.complete
ATCAGTCACCACCTGACAGTGCTCCGGTTTTAGTATCGCCTTTCGAGTGC
AGCAGAGCTCAGCCCAGCCACCATGTCCGTCCTGAAAGTATTCATCTTCG
TCGCCCTCTTCGCCGTGGCCTACTGCGCACCCAGTCCCGGCTTCTTTGGC
AAACACGAGCACCACACCATCCACGTGCCCTACAAGGTGCACACGGTGCA
CCACCATCACGTTCAGAAGGTCCATGTGCCGGTGGTGAAGCACGTGCCGG
TGCCCATTTACAAGGAGGTGCCCGTGCACCACGTCCACCACGAGGAGATC
CCCGTGCCGGTGCACCACGTCCATCACGAGGAGATCCCGGTGCACCATGT
CTTCGATGACCACCACGACCACCACGGCTGGAGCTCCCACCACGGACACG
GCTGGCTGTAAGCCATCTGCCCGCTGGCCTGCTTGTCTTCAAACCCACCC
ACTCAGCCAGTCCCATCTGAAGCAGCCTGTAAATACTGTACAATGCTAAG
TTAATGAATGTAAATAAATCACAATTCGACTGTACACAGAGCAAAAAAAA
AAAAAAAAAAAAAAAAAA

MIP13653.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-RA 737 CG14752-RA 41..584 1..544 2705 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4479151..4479535 156..540 1925 100 Plus
chr2R 21145070 chr2R 4478084..4478176 1..93 450 98.9 Plus
chr2R 21145070 chr2R 4478609..4478670 94..155 310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8591565..8591953 156..544 1930 99.7 Plus
2R 25286936 2R 8590498..8590590 1..93 465 100 Plus
2R 25286936 2R 8591023..8591084 94..155 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8592764..8593152 156..544 1930 99.7 Plus
2R 25260384 2R 8591697..8591789 1..93 465 100 Plus
2R 25260384 2R 8592222..8592283 94..155 310 100 Plus
Blast to na_te.dros performed 2019-03-16 17:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
invader2 5124 invader2 INVADER2 5124bp 719..753 127..93 121 82.9 Minus

MIP13653.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:03:09 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4478084..4478176 1..93 98 -> Plus
chr2R 4478609..4478670 94..155 100 -> Plus
chr2R 4479151..4479537 156..542 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:39 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 1..339 73..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:45 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 1..339 73..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:34 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 1..339 73..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:26 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 1..339 73..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:14 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 3..540 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:45 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 3..540 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:34 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 2..540 1..539 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:26 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 2..540 1..539 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:09 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8590498..8590590 1..93 100 -> Plus
2R 8591023..8591084 94..155 100 -> Plus
2R 8591565..8591951 156..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:09 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8590498..8590590 1..93 100 -> Plus
2R 8591023..8591084 94..155 100 -> Plus
2R 8591565..8591951 156..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:09 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8590498..8590590 1..93 100 -> Plus
2R 8591023..8591084 94..155 100 -> Plus
2R 8591565..8591951 156..542 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:34 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4478003..4478095 1..93 100 -> Plus
arm_2R 4478528..4478589 94..155 100 -> Plus
arm_2R 4479070..4479456 156..542 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:57 Download gff for MIP13653.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8592764..8593150 156..542 99   Plus
2R 8591697..8591789 1..93 100 -> Plus
2R 8592222..8592283 94..155 100 -> Plus

MIP13653.hyp Sequence

Translation from 2 to 358

> MIP13653.hyp
QSPPDSAPVLVSPFECSRAQPSHHVRPESIHLRRPLRRGLLRTQSRLLWQ
TRAPHHPRALQGAHGAPPSRSEGPCAGGEARAGAHLQGGARAPRPPRGDP
RAGAPRPSRGDPGAPCLR*
Sequence MIP13653.hyp has no blast hits.

MIP13653.pep Sequence

Translation from 72 to 410

> MIP13653.pep
MSVLKVFIFVALFAVAYCAPSPGFFGKHEHHTIHVPYKVHTVHHHHVQKV
HVPVVKHVPVPIYKEVPVHHVHHEEIPVPVHHVHHEEIPVHHVFDDHHDH
HGWSSHHGHGWL*

MIP13653.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12367-PA 114 GF12367-PA 1..91 1..89 196 92.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23367-PA 112 GG23367-PA 1..112 1..112 512 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19720-PA 111 GH19720-PA 1..111 1..111 288 71.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-PA 112 CG14752-PA 1..112 1..112 662 100 Plus
CG14052-PB 163 CG14052-PB 7..114 3..107 150 36.3 Plus
CG13482-PA 102 CG13482-PA 22..97 26..109 140 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20139-PA 110 GI20139-PA 1..110 1..111 283 70.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11083-PA 112 GL11083-PA 1..112 1..112 371 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13224-PA 112 GA13224-PA 1..112 1..112 371 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21046-PA 112 GM21046-PA 1..112 1..112 522 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10576-PA 112 GD10576-PA 1..112 1..112 522 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22417-PA 109 GJ22417-PA 1..85 1..80 270 82.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23012-PA 113 GK23012-PA 1..113 1..112 338 89.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19210-PA 112 GE19210-PA 1..112 1..112 519 99.1 Plus