MIP13665.complete Sequence
416 bp assembled on 2009-09-28
GenBank Submission: BT099869.1
> MIP13665.complete
GTTGCCAAGATTCTGCTGAGCCTGCTGCTCCTCGCTGTTGTCACCGATCT
GGTCTCAGCCCAGTGCTCCCAAAACCTGTGCCCAGTGGTCACGAACTCGA
ATCCCCGGTGCAAGGGAAAACTTCAGTATCAATGCGTTTGCGACTACACC
TGCTCCGAGTGGGACAAGCCCTGCAACTGGGTACTTACATGTCCTGAAGA
AATCGACGACATCAATGAAGTGCGCGACAAGAGAAATAAGCTAAATTTGT
TCAGATTGCCCAATCGAAACCGCCTGGAGTGCCTGGACATCAATGTCTAC
ACCATTACGCGTCCGAATTGCTGCGACTTGTTCTGCAAGTCTAAGCTTAA
AGATGTCTGTTTCTAAATAAATGTATGATCGTCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA
MIP13665.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:50:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15404-RA | 464 | CG15404-RA | 22..407 | 1..386 | 1930 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3173622..3173865 | 1..244 | 1205 | 99.6 | Plus |
chr2L | 23010047 | chr2L | 3173931..3174069 | 245..383 | 680 | 99.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:09:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3173995..3174238 | 1..244 | 1220 | 100 | Plus |
2L | 23513712 | 2L | 3174304..3174445 | 245..386 | 710 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3173995..3174238 | 1..244 | 1220 | 100 | Plus |
2L | 23513712 | 2L | 3174304..3174445 | 245..386 | 710 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 07:10:00 has no hits.
MIP13665.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:08 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3173931..3174069 | 245..383 | 99 | | Plus |
chr2L | 3173622..3173865 | 1..244 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:42 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 4..369 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:32 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 4..369 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:06 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 4..369 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:11 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 4..369 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:00:35 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 4..369 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:32 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 7..389 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:06 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 7..389 | 1..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:11 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15404-RA | 24..406 | 1..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173995..3174238 | 1..244 | 100 | -> | Plus |
2L | 3174304..3174442 | 245..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173995..3174238 | 1..244 | 100 | -> | Plus |
2L | 3174304..3174442 | 245..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173995..3174238 | 1..244 | 100 | -> | Plus |
2L | 3174304..3174442 | 245..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:06 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3173995..3174238 | 1..244 | 100 | -> | Plus |
arm_2L | 3174304..3174442 | 245..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:28 Download gff for
MIP13665.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3173995..3174238 | 1..244 | 100 | -> | Plus |
2L | 3174304..3174442 | 245..383 | 100 | | Plus |
MIP13665.pep Sequence
Translation from 0 to 365
> MIP13665.pep
VAKILLSLLLLAVVTDLVSAQCSQNLCPVVTNSNPRCKGKLQYQCVCDYT
CSEWDKPCNWVLTCPEEIDDINEVRDKRNKLNLFRLPNRNRLECLDINVY
TITRPNCCDLFCKSKLKDVCF*
MIP13665.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:51:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20042-PA | 121 | GF20042-PA | 2..121 | 1..121 | 323 | 55.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:51:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24925-PA | 122 | GG24925-PA | 2..122 | 1..121 | 481 | 82.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15404-PB | 122 | CG15404-PB | 2..122 | 1..121 | 669 | 100 | Plus |
CG15404-PA | 122 | CG15404-PA | 2..122 | 1..121 | 669 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:51:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26498-PA | 121 | GL26498-PA | 2..121 | 1..121 | 345 | 59.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:51:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13705-PA | 121 | GA13705-PA | 2..121 | 1..121 | 342 | 58.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:51:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18401-PA | 122 | GM18401-PA | 2..122 | 1..121 | 497 | 87.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:51:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23214-PA | 122 | GD23214-PA | 2..122 | 1..121 | 495 | 87.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:51:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15565-PA | 123 | GK15565-PA | 6..123 | 4..121 | 294 | 47.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:51:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18217-PA | 122 | GE18217-PA | 2..122 | 1..121 | 453 | 76.9 | Plus |
MIP13665.hyp Sequence
Translation from 0 to 365
> MIP13665.hyp
VAKILLSLLLLAVVTDLVSAQCSQNLCPVVTNSNPRCKGKLQYQCVCDYT
CSEWDKPCNWVLTCPEEIDDINEVRDKRNKLNLFRLPNRNRLECLDINVY
TITRPNCCDLFCKSKLKDVCF*
MIP13665.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15404-PB | 122 | CG15404-PB | 2..122 | 1..121 | 669 | 100 | Plus |
CG15404-PA | 122 | CG15404-PA | 2..122 | 1..121 | 669 | 100 | Plus |