Clone MIP13665 Report

Search the DGRC for MIP13665

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:136
Well:65
Vector:pOT2|pOTB7_DraIII
Protein status:MIP13665.pep: Imported from assembly
Sequenced Size:416

Clone Sequence Records

MIP13665.complete Sequence

416 bp assembled on 2009-09-28

GenBank Submission: BT099869.1

> MIP13665.complete
GTTGCCAAGATTCTGCTGAGCCTGCTGCTCCTCGCTGTTGTCACCGATCT
GGTCTCAGCCCAGTGCTCCCAAAACCTGTGCCCAGTGGTCACGAACTCGA
ATCCCCGGTGCAAGGGAAAACTTCAGTATCAATGCGTTTGCGACTACACC
TGCTCCGAGTGGGACAAGCCCTGCAACTGGGTACTTACATGTCCTGAAGA
AATCGACGACATCAATGAAGTGCGCGACAAGAGAAATAAGCTAAATTTGT
TCAGATTGCCCAATCGAAACCGCCTGGAGTGCCTGGACATCAATGTCTAC
ACCATTACGCGTCCGAATTGCTGCGACTTGTTCTGCAAGTCTAAGCTTAA
AGATGTCTGTTTCTAAATAAATGTATGATCGTCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

MIP13665.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15404-RA 464 CG15404-RA 22..407 1..386 1930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3173622..3173865 1..244 1205 99.6 Plus
chr2L 23010047 chr2L 3173931..3174069 245..383 680 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3173995..3174238 1..244 1220 100 Plus
2L 23513712 2L 3174304..3174445 245..386 710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3173995..3174238 1..244 1220 100 Plus
2L 23513712 2L 3174304..3174445 245..386 710 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:10:00 has no hits.

MIP13665.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:08 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3173931..3174069 245..383 99   Plus
chr2L 3173622..3173865 1..244 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:42 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 4..369 1..366 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:32 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 4..369 1..366 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:06 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 4..369 1..366 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:11 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 4..369 1..366 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:00:35 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 4..369 1..366 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:32 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 7..389 1..383 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:06 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 7..389 1..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:11 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
CG15404-RA 24..406 1..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173995..3174238 1..244 100 -> Plus
2L 3174304..3174442 245..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173995..3174238 1..244 100 -> Plus
2L 3174304..3174442 245..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:08 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173995..3174238 1..244 100 -> Plus
2L 3174304..3174442 245..383 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:06 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3173995..3174238 1..244 100 -> Plus
arm_2L 3174304..3174442 245..383 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:28 Download gff for MIP13665.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3173995..3174238 1..244 100 -> Plus
2L 3174304..3174442 245..383 100   Plus

MIP13665.pep Sequence

Translation from 0 to 365

> MIP13665.pep
VAKILLSLLLLAVVTDLVSAQCSQNLCPVVTNSNPRCKGKLQYQCVCDYT
CSEWDKPCNWVLTCPEEIDDINEVRDKRNKLNLFRLPNRNRLECLDINVY
TITRPNCCDLFCKSKLKDVCF*

MIP13665.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20042-PA 121 GF20042-PA 2..121 1..121 323 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24925-PA 122 GG24925-PA 2..122 1..121 481 82.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15404-PB 122 CG15404-PB 2..122 1..121 669 100 Plus
CG15404-PA 122 CG15404-PA 2..122 1..121 669 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26498-PA 121 GL26498-PA 2..121 1..121 345 59.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13705-PA 121 GA13705-PA 2..121 1..121 342 58.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18401-PA 122 GM18401-PA 2..122 1..121 497 87.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23214-PA 122 GD23214-PA 2..122 1..121 495 87.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15565-PA 123 GK15565-PA 6..123 4..121 294 47.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18217-PA 122 GE18217-PA 2..122 1..121 453 76.9 Plus

MIP13665.hyp Sequence

Translation from 0 to 365

> MIP13665.hyp
VAKILLSLLLLAVVTDLVSAQCSQNLCPVVTNSNPRCKGKLQYQCVCDYT
CSEWDKPCNWVLTCPEEIDDINEVRDKRNKLNLFRLPNRNRLECLDINVY
TITRPNCCDLFCKSKLKDVCF*

MIP13665.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15404-PB 122 CG15404-PB 2..122 1..121 669 100 Plus
CG15404-PA 122 CG15404-PA 2..122 1..121 669 100 Plus