Clone MIP13681 Report

Search the DGRC for MIP13681

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:136
Well:81
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG18428-RA
Protein status:MIP13681.pep: gold
Sequenced Size:591

Clone Sequence Records

MIP13681.complete Sequence

591 bp assembled on 2009-09-28

GenBank Submission: BT099883.1

> MIP13681.complete
TTTACGTTCACCTGCAAGCCGCATAATGGGAAAAAGTGAGAAAAAATCAA
AGAAAAAGCATAAGGAGAAGCGCAGGGAACACAAGGAAAAGCACAAGTCA
AAGAAATCCAAGAAACACAACCGAAAAAAGGAAGAATCTCCGCCGATAGC
TTCACCAACACCAATACAGCCTGAAAGGGTCAACCAGGAGGAGGAGGATG
ACTTTGCCATACCAATAGCACTGATGAATAGCAAATCACATGCCCCGGAA
ACTCCAGAGGAATACCAGCGCCGTCAGAGCCAGATCCGCAAAGAGGTGGA
CCCGGTGACGGGTCGCGTCCGGCTCATCAAAGGCGACAGTGAGGTGCTGG
AAGAGATTGTGACCAAAGAGCGCCACCTGGAGATCAACAAGAAGGCCACC
CGCGGTGATGGAGAGTTCTACGAAGCCAGATCTCTGGACGCCGCCAAGCG
TCGCAAATAGCTAATTTACCAAAAATGCAAAAATATAATAAGCTATTTCA
TGACTTGTAGTAATAATTAATAACTGTCAGTTTAATTAAACAAAGGGCTA
GCTAGCGACTATATGTACACGCGAAAAAAAAAAAAAAAAAA

MIP13681.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG18428-RA 677 CG18428-RA 105..677 1..573 2865 100 Plus
CG13605-RB 2280 CG13605-RB 2211..2280 576..507 350 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19932972..19933328 217..573 1755 99.4 Plus
chr3R 27901430 chr3R 19932689..19932906 1..218 955 95.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24109654..24110013 217..576 1800 100 Plus
3R 32079331 3R 24109371..24109588 1..218 1090 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23850485..23850844 217..576 1800 100 Plus
3R 31820162 3R 23850202..23850419 1..218 1090 100 Plus
Blast to na_te.dros performed 2019-03-16 01:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 3..90 456..544 136 67.4 Plus

MIP13681.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:00:24 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19932689..19932906 1..218 95 -> Plus
chr3R 19932974..19933328 219..573 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:54 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..435 26..460 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:01 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..435 26..460 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:10 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..435 26..460 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:54:15 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..435 26..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 14:11:16 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..563 11..573 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:01 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 1..563 11..573 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:10 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 5..577 1..573 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:54:15 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG18428-RA 5..577 1..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:24 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24109656..24110010 219..573 100   Plus
3R 24109371..24109588 1..218 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:24 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24109656..24110010 219..573 100   Plus
3R 24109371..24109588 1..218 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:24 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24109656..24110010 219..573 100   Plus
3R 24109371..24109588 1..218 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:10 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19935093..19935310 1..218 100 -> Plus
arm_3R 19935378..19935732 219..573 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:44 Download gff for MIP13681.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23850202..23850419 1..218 100 -> Plus
3R 23850487..23850841 219..573 100   Plus

MIP13681.hyp Sequence

Translation from 0 to 459

> MIP13681.hyp
LRSPASRIMGKSEKKSKKKHKEKRREHKEKHKSKKSKKHNRKKEESPPIA
SPTPIQPERVNQEEEDDFAIPIALMNSKSHAPETPEEYQRRQSQIRKEVD
PVTGRVRLIKGDSEVLEEIVTKERHLEINKKATRGDGEFYEARSLDAAKR
RK*

MIP13681.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG18428-PA 144 CG18428-PA 1..144 9..152 739 100 Plus
CG18428-PC 78 CG18428-PC 1..78 75..152 394 100 Plus
CG18428-PB 66 CG18428-PB 1..64 9..72 337 100 Plus

MIP13681.pep Sequence

Translation from 1 to 459

> MIP13681.pep
LRSPASRIMGKSEKKSKKKHKEKRREHKEKHKSKKSKKHNRKKEESPPIA
SPTPIQPERVNQEEEDDFAIPIALMNSKSHAPETPEEYQRRQSQIRKEVD
PVTGRVRLIKGDSEVLEEIVTKERHLEINKKATRGDGEFYEARSLDAAKR
RK*

MIP13681.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16321-PA 144 GF16321-PA 1..144 9..152 425 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11253-PA 143 GG11253-PA 37..143 45..152 524 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18492-PA 164 GH18492-PA 71..160 65..151 377 77.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18428-PA 144 CG18428-PA 1..144 9..152 739 100 Plus
CG18428-PC 78 CG18428-PC 1..78 75..152 394 100 Plus
CG18428-PB 66 CG18428-PB 1..64 9..72 337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24166-PA 153 GI24166-PA 1..150 9..151 414 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23403-PA 142 GL23403-PA 55..142 65..152 423 87.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14933-PA 142 GA14933-PA 55..142 65..152 423 87.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26557-PA 144 GM26557-PA 1..144 9..152 709 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21064-PA 144 GD21064-PA 1..144 9..152 713 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14199-PA 147 GJ14199-PA 33..136 41..145 376 67.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11155-PA 150 GK11155-PA 25..146 32..151 413 67.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23446-PA 144 GE23446-PA 37..144 45..152 541 95.4 Plus