Clone MIP13731 Report

Search the DGRC for MIP13731

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:137
Well:31
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13135-RA
Protein status:MIP13731.pep: gold
Sequenced Size:574

Clone Sequence Records

MIP13731.complete Sequence

574 bp assembled on 2009-09-28

GenBank Submission: BT099882.1

> MIP13731.complete
CAAGCATCAGCAACATGAGGAAATCACTACTGATCGTTGGCTCCCTCCTG
GTGACCATCTTTCTGGCCCATCTGCCAGTTGGTCTAGCCGTCTCGTGTGC
CGATGATCCCACCGATACGGCTTGCATCGATTGCACAGATACCGCGAATG
CAGCTGAAGCCGATTGTACCACAACCACGGCTGCTCCGGAGGTAACCACA
GCTGCCGCAGAGGTAACCACAGCGGCCAGTGCCGATGGAGAAACCACCAC
CGCAGCCGCTTCGGCCACCGACACGACCACCGCCTCATCCGGAGGCAGTG
GCAAGAAGCGCGTGAGGAGGACCTTCAGGCGTAAGGTGAGCCGCCCCAGG
AAGATCAAGAAGAGGAGGAGCAACCGAGGCAGGAACAATAGGAGGAGCCA
AAACTCGGGCTAAGCACTGGACGCTCAATCGCTCAAGAATGATAACAACA
ATGACAAGGCAATGCTACCCTGTACTCCTAAACAGCTTTAGTTTTAAGTA
AACAAATCAATTTTAAACTGGGCCCACAAATAATAAATTATTTTTTTAAA
GAAAGTTTAAAAAAAAAAAAAAAA

MIP13731.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13135-RA 572 CG13135-RA 19..572 1..554 2770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10121101..10121658 558..1 2790 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10122193..10122753 561..1 2805 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10122193..10122753 561..1 2805 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:10:40 has no hits.

MIP13731.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:30 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10121132..10121658 1..527 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:54 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 1..399 15..413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:59 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 1..399 15..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:23 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 1..399 15..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:37 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 1..399 15..413 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 14:11:17 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 19..572 1..554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:59 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 19..576 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:23 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 19..576 1..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:37 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
CG13135-RA 19..576 1..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:30 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10122196..10122753 1..558 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:30 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10122196..10122753 1..558 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:30 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10122196..10122753 1..558 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:23 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10122196..10122753 1..558 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:42 Download gff for MIP13731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10122196..10122753 1..558 100   Minus

MIP13731.hyp Sequence

Translation from 2 to 412

> MIP13731.hyp
SISNMRKSLLIVGSLLVTIFLAHLPVGLAVSCADDPTDTACIDCTDTANA
AEADCTTTTAAPEVTTAAAEVTTAASADGETTTAAASATDTTTASSGGSG
KKRVRRTFRRKVSRPRKIKKRRSNRGRNNRRSQNSG*

MIP13731.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13135-PC 132 CG13135-PC 1..132 5..136 658 100 Plus
CG13135-PA 132 CG13135-PA 1..132 5..136 658 100 Plus
ng2-PA 112 CG14266-PA 14..107 42..134 167 43.8 Plus
ng1-PA 107 CG10781-PA 14..105 42..132 166 44.7 Plus
CG8087-PA 142 CG8087-PA 23..126 29..135 158 36.6 Plus

MIP13731.pep Sequence

Translation from 2 to 412

> MIP13731.pep
SISNMRKSLLIVGSLLVTIFLAHLPVGLAVSCADDPTDTACIDCTDTANA
AEADCTTTTAAPEVTTAAAEVTTAASADGETTTAAASATDTTTASSGGSG
KKRVRRTFRRKVSRPRKIKKRRSNRGRNNRRSQNSG*

MIP13731.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23979-PA 184 GG23979-PA 1..71 5..85 218 61.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13135-PC 132 CG13135-PC 1..132 5..136 658 100 Plus
CG13135-PA 132 CG13135-PA 1..132 5..136 658 100 Plus
ng2-PA 112 CG14266-PA 14..107 42..134 167 43.8 Plus
ng1-PA 107 CG10781-PA 14..105 42..132 166 44.7 Plus
CG8087-PA 142 CG8087-PA 23..126 29..135 158 36.6 Plus
CG14851-PA 152 CG14851-PA 1..124 5..135 156 34.6 Plus
CG33267-PB 94 CG33267-PB 11..93 40..128 146 41.6 Plus
CG7377-PA 94 CG7377-PA 25..93 56..128 140 45.2 Plus
CG14850-PA 158 CG14850-PA 1..155 5..134 140 31.4 Plus
CG12546-PA 117 CG12546-PA 20..104 52..133 135 37.6 Plus
CG14452-PA 117 CG14452-PA 20..104 52..133 135 37.6 Plus
CG33268-PA 94 CG33268-PA 25..93 56..128 134 43.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11994-PA 130 GM11994-PA 1..130 5..136 393 84.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22304-PA 201 GD22304-PA 1..105 5..111 380 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12729-PA 110 GJ12729-PA 1..52 5..56 139 46.2 Plus
Dvir\GJ15355-PA 149 GJ15355-PA 1..51 5..55 138 52.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26417-PA 180 GE26417-PA 1..51 5..55 224 82.4 Plus