Clone MIP13858 Report

Search the DGRC for MIP13858

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:138
Well:58
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG15034-RA
Protein status:MIP13858.pep: gold
Sequenced Size:817

Clone Sequence Records

MIP13858.complete Sequence

817 bp assembled on 2009-09-29

GenBank Submission: BT099900.1

> MIP13858.complete
TAAGTTGATTGTCACAGTCCTACGGCTCGAACATTTGGATATAGTTTAGT
TTTCTCTGACCCGGTGAACGATAAGCAACCAAAAATTTAGGAATACAATA
CAATACAATACAATAGAATACAAAATTTATAAATTTTTTTTCTTTACAAA
ATCGCAAGCAACAGTATCTAGGAAAATCCAATACAATCCAATTCAATCCA
GTAGGGACTGAAGTCATGGCGTTAAAGATGAATCAATACCAGAACCAGGT
CAAGATAAACTACGTGCAACAATATGTGGGTAGGGTGGCTGGTCCCCTAG
TCGAGCCCATTTTCCCCGTGCCGCAAATGTCATCGGCAACCCTACGAGTC
CGTCGAGCTGTCGTCGAATCCTATCGCGGACCCCAAATTGCTCCCGATGA
TGCCATGCTCCCGATGCCGCCCCACAACAAGGCTCAAAATATGTCTGAGA
TTCTGCACGACCTTCAATTCAAGCTGAAAGATTTCAAGCTGTGGAATCAA
GTCATTCGTCTTCTGAAGAAACGGGTCTAGTCTGGACGTATAGATGTAAT
GCGCAACTGACGGATCGGAGTCTACGCCTTATTCCTCCGTCTACTCTCAA
AATCCCAACTAAAAAAGTTCGAATTGCGTTCGGTGTTTGGTTGTACAATC
CATTATAAACACCGTAAAATCGATTACATGTATTTTAAGTCTGGCGTCCT
CTCCAAATTTGTATTCACAAATTATTTATCAAATGTTAATCAAAATTGAA
TTACAAAAAAAAAAGTGCAAGGAATAAAGGGTGCAAGCAATGCTAAAAAA
AAAAAAAAAAAAAAAAA

MIP13858.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-RA 518 CG15034-RA 1..518 13..530 2590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7238644..7239437 794..1 3970 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7346711..7347506 796..1 3980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7354809..7355604 796..1 3980 100 Minus
Blast to na_te.dros performed 2019-03-16 21:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1055..1160 757..652 115 60.2 Minus
Tabor 7345 Tabor TABOR 7345bp 1139..1206 704..766 112 67.6 Plus

MIP13858.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:36:05 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7238644..7239437 1..794 92   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:07 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..315 216..530 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:39 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..315 216..530 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:38 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..315 216..530 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:20 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..315 216..530 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-29 11:42:00 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..518 13..530 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:39 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:38 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:20 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 1..794 1..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:05 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
X 7346713..7347506 1..794 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:05 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
X 7346713..7347506 1..794 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:05 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
X 7346713..7347506 1..794 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:38 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7240746..7241539 1..794 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:10 Download gff for MIP13858.complete
Subject Subject Range Query Range Percent Splice Strand
X 7354811..7355604 1..794 100   Minus

MIP13858.hyp Sequence

Translation from 215 to 529

> MIP13858.hyp
MALKMNQYQNQVKINYVQQYVGRVAGPLVEPIFPVPQMSSATLRVRRAVV
ESYRGPQIAPDDAMLPMPPHNKAQNMSEILHDLQFKLKDFKLWNQVIRLL
KKRV*

MIP13858.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-PB 104 CG15034-PB 1..104 1..104 537 100 Plus
CG15034-PA 104 CG15034-PA 1..104 1..104 537 100 Plus

MIP13858.pep Sequence

Translation from 215 to 529

> MIP13858.pep
MALKMNQYQNQVKINYVQQYVGRVAGPLVEPIFPVPQMSSATLRVRRAVV
ESYRGPQIAPDDAMLPMPPHNKAQNMSEILHDLQFKLKDFKLWNQVIRLL
KKRV*

MIP13858.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21133-PA 108 GF21133-PA 14..96 23..104 232 50.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17624-PA 104 GG17624-PA 1..104 1..104 483 87.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-PB 104 CG15034-PB 1..104 1..104 537 100 Plus
CG15034-PA 104 CG15034-PA 1..104 1..104 537 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14936-PA 111 GI14936-PA 54..109 44..102 142 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17471-PA 100 GM17471-PA 1..100 5..104 513 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16156-PA 100 GD16156-PA 1..100 5..104 512 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18964-PA 72 GJ18964-PA 1..72 32..104 163 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16473-PA 109 GK16473-PA 32..109 28..104 164 44.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17526-PA 100 GE17526-PA 1..100 5..104 424 81 Plus