Clone MIP13928 Report

Search the DGRC for MIP13928

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:139
Well:28
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13059-RA
Protein status:MIP13928.pep: gold
Sequenced Size:599

Clone Sequence Records

MIP13928.complete Sequence

599 bp assembled on 2009-09-28

GenBank Submission: BT099848.1

> MIP13928.complete
AGCAGTTGCAATCGATTCAGCAATCACAGCATACCCCCCAAAAAAAAACC
AATCCAAAGATGTTCAAATTCGTCGCCTTCTTCGCTTGCCTGGCTGTGGC
CGCCGCTGCCCCCGGTCTGATTGCCGAGACCCACTCGATTGTCCAGCCGG
CGATTCTTGCCAAGACTGCCTACGTGGACACCAGCGCCTCCTCGGCCATC
ACCCACCAGAGCAACGTGAACCTGGTGCGCAAGGTGCCAGTGGTCTACTC
CGCCCCGGTTGTTCATGCTGCCCCAGTGGTACATGCCGCTCCTCTGGTCA
AGACTGTGATCCCTGCCGCTCCCCTGGTCAAGACTGTGATCCCTGCCGCT
CCCGTCCTTAAGACTGTGGTCTCCTCTGCTCCTCTGGTCCACACTGTCGT
CCCAGCCGCTCCACTGGTCAAGACCGTCATCCCAGCTGCTCCGGTTATCA
AGACCGTGATCCCAGCTGCCCCTCTGGTTCACACCGTCCACAGCGCCCCA
GTTGTCTACTCCGCCTACCACAAGTGAATCGATTGAAAGCGAACTTATAT
GGTTATGATAAATTTGTTGAACAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP13928.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-RA 721 CG13059-RA 38..624 1..587 2890 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16313526..16314026 72..572 2505 100 Plus
chr3L 24539361 chr3L 16313390..16313462 1..73 365 100 Plus
chr3L 24539361 chr3L 16313738..16313893 314..469 285 78.8 Plus
chr3L 24539361 chr3L 16313768..16313923 284..439 285 78.8 Plus
chr3L 24539361 chr3L 16313742..16313852 378..488 225 80.2 Plus
chr3L 24539361 chr3L 16313832..16313942 288..398 225 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16323808..16324323 72..587 2535 99.4 Plus
3L 28110227 3L 16323672..16323744 1..73 365 100 Plus
3L 28110227 3L 16324020..16324175 314..469 285 78.8 Plus
3L 28110227 3L 16324050..16324205 284..439 285 78.8 Plus
3L 28110227 3L 16324024..16324134 378..488 225 80.2 Plus
3L 28110227 3L 16324114..16324224 288..398 225 80.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16316908..16317423 72..587 2535 99.4 Plus
3L 28103327 3L 16316772..16316844 1..73 365 100 Plus
Blast to na_te.dros performed 2019-03-16 12:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dnet\R1B 2038 Dnet\R1B NETR1B 2038bp 1288..1328 312..273 121 80.5 Minus

MIP13928.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:17:08 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16313390..16313460 1..71 100 -> Plus
chr3L 16313526..16314026 72..572 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:38 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..468 60..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:48 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..468 60..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:22:46 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..468 60..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:57 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..468 60..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:11 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..468 60..527 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:48 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..572 1..572 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:22:46 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..572 1..572 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:57 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
CG13059-RA 1..572 1..572 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:08 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16323672..16323742 1..71 100 -> Plus
3L 16323808..16324308 72..572 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:08 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16323672..16323742 1..71 100 -> Plus
3L 16323808..16324308 72..572 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:08 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16323672..16323742 1..71 100 -> Plus
3L 16323808..16324308 72..572 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:22:46 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16316772..16316842 1..71 100 -> Plus
arm_3L 16316908..16317408 72..572 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:00 Download gff for MIP13928.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16316908..16317408 72..572 100   Plus
3L 16316772..16316842 1..71 100 -> Plus

MIP13928.hyp Sequence

Translation from 2 to 526

> MIP13928.hyp
QLQSIQQSQHTPQKKTNPKMFKFVAFFACLAVAAAAPGLIAETHSIVQPA
ILAKTAYVDTSASSAITHQSNVNLVRKVPVVYSAPVVHAAPVVHAAPLVK
TVIPAAPLVKTVIPAAPVLKTVVSSAPLVHTVVPAAPLVKTVIPAAPVIK
TVIPAAPLVHTVHSAPVVYSAYHK*

MIP13928.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-PA 155 CG13059-PA 1..155 20..174 764 100 Plus
CG13040-PB 185 CG13040-PB 1..144 20..173 234 39.4 Plus
CG13040-PA 185 CG13040-PA 1..144 20..173 234 39.4 Plus
CG13060-PA 131 CG13060-PA 1..131 20..173 213 42.9 Plus
CG13041-PA 124 CG13041-PA 1..123 20..163 203 45.2 Plus

MIP13928.pep Sequence

Translation from 2 to 526

> MIP13928.pep
QLQSIQQSQHTPQKKTNPKMFKFVAFFACLAVAAAAPGLIAETHSIVQPA
ILAKTAYVDTSASSAITHQSNVNLVRKVPVVYSAPVVHAAPVVHAAPLVK
TVIPAAPLVKTVIPAAPVLKTVVSSAPLVHTVVPAAPLVKTVIPAAPVIK
TVIPAAPLVHTVHSAPVVYSAYHK*

MIP13928.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24182-PA 155 GF24182-PA 1..155 20..174 460 79.3 Plus
Dana\GF24178-PA 138 GF24178-PA 1..135 20..161 142 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15987-PA 157 GG15987-PA 1..157 20..174 591 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15878-PA 143 GH15878-PA 1..143 20..174 306 55.7 Plus
Dgri\GH15877-PA 123 GH15877-PA 1..123 20..173 144 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13059-PA 155 CG13059-PA 1..155 20..174 764 100 Plus
CG13040-PB 185 CG13040-PB 1..144 20..173 234 39.4 Plus
CG13040-PA 185 CG13040-PA 1..144 20..173 234 39.4 Plus
CG13060-PA 131 CG13060-PA 1..131 20..173 213 42.9 Plus
CG13041-PA 124 CG13041-PA 1..123 20..163 203 45.2 Plus
CG13044-PA 155 CG13044-PA 1..152 20..171 168 37.5 Plus
CG13043-PA 148 CG13043-PA 1..143 20..161 164 38.4 Plus
CG34205-PA 217 CG34205-PA 10..177 8..168 143 33.3 Plus
CG14095-PA 162 CG14095-PA 1..133 20..169 138 33.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16527-PA 131 GI16527-PA 1..131 20..174 318 52.5 Plus
Dmoj\GI12654-PA 131 GI12654-PA 1..131 20..174 315 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12011-PA 157 GA12011-PA 1..157 20..174 396 71.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25618-PA 157 GM25618-PA 1..157 20..174 603 94.3 Plus
Dsec\GM24415-PA 185 GM24415-PA 1..121 20..160 157 39 Plus
Dsec\GM24416-PA 136 GM24416-PA 1..134 20..112 134 39 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14623-PA 157 GD14623-PA 1..157 20..174 603 94.3 Plus
Dsim\GD12485-PA 185 GD12485-PA 1..121 20..160 160 40.4 Plus
Dsim\GD12487-PA 136 GD12487-PA 1..134 20..112 134 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12780-PA 127 GJ12780-PA 1..125 20..133 255 63.5 Plus
Dvir\GJ12631-PA 123 GJ12631-PA 1..121 20..122 135 41.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16561-PA 140 GK16561-PA 1..134 20..130 225 52.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19552-PA 157 GE19552-PA 1..157 20..174 578 91.1 Plus
Dyak\GE19549-PA 163 GE19549-PA 1..163 20..174 572 87.7 Plus
Dyak\GE19548-PA 136 GE19548-PA 1..134 20..112 135 38.2 Plus