Clone MIP13947 Report

Search the DGRC for MIP13947

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:139
Well:47
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14332-RA
Protein status:MIP13947.pep: gold
Sequenced Size:530

Clone Sequence Records

MIP13947.complete Sequence

530 bp assembled on 2009-09-28

GenBank Submission: BT099850.1

> MIP13947.complete
CACACAATTAAAAGACCTATTTCAAAATGGCACTCTATTATATTTTGGTG
ATCAGTGTCCTGCTTGTCCTCGCCCAAGGATCGTATTTGTCGTCGGTGAA
TCAGGAATCCGGGGTGGGAGTGCATCAGTCTGGAGCTATTTCATCTAGAG
CTCCAGCTGCCGGAATAACCCGTGGCTACTCCGCTGCCCCTCAGACCCAA
CGACCCATCTCTGGATATGGATCCCTCTCTGGTCCTGTTGGAGGATCCCG
TCGAGTGCCCGTAGTTGGAGTGACCGGATCTCGTCCTCGTGGTGGAGCTC
CGCGTAGTCCGTCTGCTGGAGCTCATGGACGTCCAAATGTAGGTGGATCT
GCCCATGGAAATTCCTACCAGAATCGCCAACGCAGCCAAAAGCCTTATTA
AGAAACAGAACTTATCATCAGCAAATGACCAAACCTAGATCTACATCCTT
ATTGTCACATTCTTATTCTACTCTCAAACCTTTTTCTATCGCAAATAATA
ACAAATGTTACATAAAAAAAAAAAAAAAAA

MIP13947.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14332-RA 513 CG14332-RA 1..513 1..513 2565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13246041..13246553 513..1 2520 99.4 Minus
chr3R 27901430 chr3R 13243335..13243469 220..354 225 77.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17421685..17422202 518..1 2590 100 Minus
3R 32079331 3R 17418978..17419112 220..354 225 77.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17162516..17163033 518..1 2590 100 Minus
3R 31820162 3R 17159809..17159943 220..354 225 77.7 Plus
Blast to na_te.dros performed on 2019-03-16 20:39:30 has no hits.

MIP13947.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:40:32 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13246041..13246553 1..513 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:37 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:54 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:31 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:09 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:53 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..513 1..513 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..513 1..513 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:31 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
CG14332-RA 1..513 1..513 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17421690..17422202 1..513 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17421690..17422202 1..513 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17421690..17422202 1..513 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:22 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13247412..13247924 1..513 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:02 Download gff for MIP13947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17162521..17163033 1..513 100   Minus

MIP13947.pep Sequence

Translation from 26 to 400

> MIP13947.pep
MALYYILVISVLLVLAQGSYLSSVNQESGVGVHQSGAISSRAPAAGITRG
YSAAPQTQRPISGYGSLSGPVGGSRRVPVVGVTGSRPRGGAPRSPSAGAH
GRPNVGGSAHGNSYQNRQRSQKPY*

MIP13947.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16774-PA 124 GG16774-PA 1..124 1..124 395 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14332-PA 124 CG14332-PA 1..124 1..124 632 100 Plus
CG42834-PA 122 CG42834-PA 1..122 1..124 304 54.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15364-PA 124 GM15364-PA 1..124 1..124 536 90.3 Plus
Dsec\GM15234-PA 122 GM15234-PA 1..122 1..124 257 59.7 Plus
Dsec\GM15235-PA 148 GM15235-PA 1..148 1..124 163 36.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20233-PA 123 GD20233-PA 1..123 1..124 525 91.9 Plus
Dsim\GD19159-PA 122 GD19159-PA 1..122 1..124 261 59.7 Plus
Dsim\GD19160-PA 148 GD19160-PA 1..148 1..124 159 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25271-PA 124 GE25271-PA 1..124 1..124 376 76.6 Plus
Dyak\GE10133-PA 142 GE10133-PA 1..142 1..124 247 47.9 Plus
Dyak\GE10134-PA 150 GE10134-PA 1..150 1..124 152 35.8 Plus

MIP13947.hyp Sequence

Translation from 26 to 400

> MIP13947.hyp
MALYYILVISVLLVLAQGSYLSSVNQESGVGVHQSGAISSRAPAAGITRG
YSAAPQTQRPISGYGSLSGPVGGSRRVPVVGVTGSRPRGGAPRSPSAGAH
GRPNVGGSAHGNSYQNRQRSQKPY*

MIP13947.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14332-PA 124 CG14332-PA 1..124 1..124 632 100 Plus
CG42834-PA 122 CG42834-PA 1..122 1..124 304 54.8 Plus