MIP13947.complete Sequence
530 bp assembled on 2009-09-28
GenBank Submission: BT099850.1
> MIP13947.complete
CACACAATTAAAAGACCTATTTCAAAATGGCACTCTATTATATTTTGGTG
ATCAGTGTCCTGCTTGTCCTCGCCCAAGGATCGTATTTGTCGTCGGTGAA
TCAGGAATCCGGGGTGGGAGTGCATCAGTCTGGAGCTATTTCATCTAGAG
CTCCAGCTGCCGGAATAACCCGTGGCTACTCCGCTGCCCCTCAGACCCAA
CGACCCATCTCTGGATATGGATCCCTCTCTGGTCCTGTTGGAGGATCCCG
TCGAGTGCCCGTAGTTGGAGTGACCGGATCTCGTCCTCGTGGTGGAGCTC
CGCGTAGTCCGTCTGCTGGAGCTCATGGACGTCCAAATGTAGGTGGATCT
GCCCATGGAAATTCCTACCAGAATCGCCAACGCAGCCAAAAGCCTTATTA
AGAAACAGAACTTATCATCAGCAAATGACCAAACCTAGATCTACATCCTT
ATTGTCACATTCTTATTCTACTCTCAAACCTTTTTCTATCGCAAATAATA
ACAAATGTTACATAAAAAAAAAAAAAAAAA
MIP13947.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:49:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14332-RA | 513 | CG14332-RA | 1..513 | 1..513 | 2565 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:39:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13246041..13246553 | 513..1 | 2520 | 99.4 | Minus |
chr3R | 27901430 | chr3R | 13243335..13243469 | 220..354 | 225 | 77.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:39:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17421685..17422202 | 518..1 | 2590 | 100 | Minus |
3R | 32079331 | 3R | 17418978..17419112 | 220..354 | 225 | 77.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17162516..17163033 | 518..1 | 2590 | 100 | Minus |
3R | 31820162 | 3R | 17159809..17159943 | 220..354 | 225 | 77.7 | Plus |
Blast to na_te.dros performed on 2019-03-16 20:39:30 has no hits.
MIP13947.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:40:32 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13246041..13246553 | 1..513 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:37 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..375 | 27..401 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:54 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..375 | 27..401 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..375 | 27..401 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:31 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..375 | 27..401 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:09 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..375 | 27..401 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:53 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..513 | 1..513 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..513 | 1..513 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:31 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14332-RA | 1..513 | 1..513 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17421690..17422202 | 1..513 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17421690..17422202 | 1..513 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:40:32 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17421690..17422202 | 1..513 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:22 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13247412..13247924 | 1..513 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:02 Download gff for
MIP13947.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17162521..17163033 | 1..513 | 100 | | Minus |
MIP13947.pep Sequence
Translation from 26 to 400
> MIP13947.pep
MALYYILVISVLLVLAQGSYLSSVNQESGVGVHQSGAISSRAPAAGITRG
YSAAPQTQRPISGYGSLSGPVGGSRRVPVVGVTGSRPRGGAPRSPSAGAH
GRPNVGGSAHGNSYQNRQRSQKPY*
MIP13947.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16774-PA | 124 | GG16774-PA | 1..124 | 1..124 | 395 | 80 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14332-PA | 124 | CG14332-PA | 1..124 | 1..124 | 632 | 100 | Plus |
CG42834-PA | 122 | CG42834-PA | 1..122 | 1..124 | 304 | 54.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15364-PA | 124 | GM15364-PA | 1..124 | 1..124 | 536 | 90.3 | Plus |
Dsec\GM15234-PA | 122 | GM15234-PA | 1..122 | 1..124 | 257 | 59.7 | Plus |
Dsec\GM15235-PA | 148 | GM15235-PA | 1..148 | 1..124 | 163 | 36.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20233-PA | 123 | GD20233-PA | 1..123 | 1..124 | 525 | 91.9 | Plus |
Dsim\GD19159-PA | 122 | GD19159-PA | 1..122 | 1..124 | 261 | 59.7 | Plus |
Dsim\GD19160-PA | 148 | GD19160-PA | 1..148 | 1..124 | 159 | 36.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25271-PA | 124 | GE25271-PA | 1..124 | 1..124 | 376 | 76.6 | Plus |
Dyak\GE10133-PA | 142 | GE10133-PA | 1..142 | 1..124 | 247 | 47.9 | Plus |
Dyak\GE10134-PA | 150 | GE10134-PA | 1..150 | 1..124 | 152 | 35.8 | Plus |
MIP13947.hyp Sequence
Translation from 26 to 400
> MIP13947.hyp
MALYYILVISVLLVLAQGSYLSSVNQESGVGVHQSGAISSRAPAAGITRG
YSAAPQTQRPISGYGSLSGPVGGSRRVPVVGVTGSRPRGGAPRSPSAGAH
GRPNVGGSAHGNSYQNRQRSQKPY*
MIP13947.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14332-PA | 124 | CG14332-PA | 1..124 | 1..124 | 632 | 100 | Plus |
CG42834-PA | 122 | CG42834-PA | 1..122 | 1..124 | 304 | 54.8 | Plus |