BDGP Sequence Production Resources |
Search the DGRC for MIP13951
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 139 |
Well: | 51 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG14573-RA |
Protein status: | MIP13951.pep: gold |
Sequenced Size: | 686 |
686 bp assembled on 2009-09-28
GenBank Submission: BT099894.1
> MIP13951.complete CCCACGATCATGGCACGTTACCAGTTTTTCAGTTCGCTCCTCCTCCTGCT GGCGGCCATCAGCGCGGTGAATTGTGCGGCACAGGCACCACTTCGGCGGA CTCTGCGCCTGCGTCCGGTGGCGTTCGCCCGGCAGGAGCTGGCTCCCACC CCCTACCCCTCGGCTGCTGAGCTTAAACCCGCCGCCGAACAGCCCGCGCT GACCTACGGACCTCCCGAGGATGTGGATACAGATGCCTTGCCTTCGGAAC AGGATCCACCAGTGGACACCTTCGAGCCTAGCCCAGAGAACGAGGAGGTG GACACCGAGGAGAGCTCACTTGAGGCCACCACACCATCCTCTGCTCCGGC CCGCCTGCGCAGCCGCCATAGATTGGGCAAGTTGCAGCTGGCTAAGCCAA AGCTGCTCCGCCAACGCACAGCTCGCCTGGAGGAGCTGCCCGTGGATGCG GCTGTGGCTCCAGTGGCTTCGCTGGTTCCAGTAGCTCAGGCTCCAGCACT GGCCACGCCCCAGTTTTACTATGTGGGTGCCCAGCAGCCGTATTACCTGG CAGCCTACAGCGCTGCTCCCCAGCAACTAGGCTGGTAGTAACGCTAGTTG CCTTCTCTTAATTTGTTCTGTTTGGATTGCAATTTGTTGTTAAAAATATA TTTCTGCTAATATGTTTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14573-RA | 667 | CG14573-RA | 1..667 | 1..667 | 3335 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21723057..21723723 | 1..667 | 3335 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21734122..21734793 | 1..672 | 3360 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21727222..21727893 | 1..672 | 3360 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TAHRE | 10463 | TAHRE OSV 10463bp | 9271..9323 | 663..608 | 110 | 71.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21723057..21723723 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 1..579 | 10..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 1..579 | 10..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 1..579 | 10..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 1..579 | 10..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 1..579 | 10..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 24..690 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 24..690 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14573-RA | 24..690 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21734122..21734788 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21734122..21734788 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21734122..21734788 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21727222..21727888 | 1..667 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21727222..21727888 | 1..667 | 100 | Plus |
Translation from 0 to 587
> MIP13951.pep PTIMARYQFFSSLLLLLAAISAVNCAAQAPLRRTLRLRPVAFARQELAPT PYPSAAELKPAAEQPALTYGPPEDVDTDALPSEQDPPVDTFEPSPENEEV DTEESSLEATTPSSAPARLRSRHRLGKLQLAKPKLLRQRTARLEELPVDA AVAPVASLVPVAQAPALATPQFYYVGAQQPYYLAAYSAAPQQLGW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25166-PA | 192 | GF25166-PA | 1..192 | 4..195 | 481 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16220-PA | 191 | GG16220-PA | 1..191 | 4..195 | 756 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16370-PA | 187 | GH16370-PA | 1..187 | 4..195 | 378 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14573-PA | 192 | CG14573-PA | 1..192 | 4..195 | 971 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11561-PA | 191 | GI11561-PA | 1..191 | 4..195 | 383 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24858-PA | 185 | GL24858-PA | 16..185 | 23..195 | 437 | 62 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13091-PA | 185 | GA13091-PA | 1..185 | 4..195 | 507 | 63.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22402-PA | 192 | GM22402-PA | 1..192 | 4..195 | 797 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14990-PA | 69 | GD14990-PA | 1..69 | 4..72 | 321 | 94.2 | Plus |
Dsim\GD14991-PA | 87 | GD14991-PA | 4..87 | 112..195 | 276 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11241-PA | 191 | GJ11241-PA | 1..191 | 4..195 | 376 | 59.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17060-PA | 199 | GK17060-PA | 1..199 | 4..195 | 295 | 46.8 | Plus |
Translation from 0 to 587
> MIP13951.hyp PTIMARYQFFSSLLLLLAAISAVNCAAQAPLRRTLRLRPVAFARQELAPT PYPSAAELKPAAEQPALTYGPPEDVDTDALPSEQDPPVDTFEPSPENEEV DTEESSLEATTPSSAPARLRSRHRLGKLQLAKPKLLRQRTARLEELPVDA AVAPVASLVPVAQAPALATPQFYYVGAQQPYYLAAYSAAPQQLGW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14573-PA | 192 | CG14573-PA | 1..192 | 4..195 | 971 | 100 | Plus |