Clone MIP13951 Report

Search the DGRC for MIP13951

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:139
Well:51
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14573-RA
Protein status:MIP13951.pep: gold
Sequenced Size:686

Clone Sequence Records

MIP13951.complete Sequence

686 bp assembled on 2009-09-28

GenBank Submission: BT099894.1

> MIP13951.complete
CCCACGATCATGGCACGTTACCAGTTTTTCAGTTCGCTCCTCCTCCTGCT
GGCGGCCATCAGCGCGGTGAATTGTGCGGCACAGGCACCACTTCGGCGGA
CTCTGCGCCTGCGTCCGGTGGCGTTCGCCCGGCAGGAGCTGGCTCCCACC
CCCTACCCCTCGGCTGCTGAGCTTAAACCCGCCGCCGAACAGCCCGCGCT
GACCTACGGACCTCCCGAGGATGTGGATACAGATGCCTTGCCTTCGGAAC
AGGATCCACCAGTGGACACCTTCGAGCCTAGCCCAGAGAACGAGGAGGTG
GACACCGAGGAGAGCTCACTTGAGGCCACCACACCATCCTCTGCTCCGGC
CCGCCTGCGCAGCCGCCATAGATTGGGCAAGTTGCAGCTGGCTAAGCCAA
AGCTGCTCCGCCAACGCACAGCTCGCCTGGAGGAGCTGCCCGTGGATGCG
GCTGTGGCTCCAGTGGCTTCGCTGGTTCCAGTAGCTCAGGCTCCAGCACT
GGCCACGCCCCAGTTTTACTATGTGGGTGCCCAGCAGCCGTATTACCTGG
CAGCCTACAGCGCTGCTCCCCAGCAACTAGGCTGGTAGTAACGCTAGTTG
CCTTCTCTTAATTTGTTCTGTTTGGATTGCAATTTGTTGTTAAAAATATA
TTTCTGCTAATATGTTTAAAAAAAAAAAAAAAAAAA

MIP13951.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14573-RA 667 CG14573-RA 1..667 1..667 3335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21723057..21723723 1..667 3335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21734122..21734793 1..672 3360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21727222..21727893 1..672 3360 100 Plus
Blast to na_te.dros performed 2019-03-16 00:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 9271..9323 663..608 110 71.4 Minus

MIP13951.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:53:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21723057..21723723 1..667 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:02 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:26 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:16:31 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 16:22:38 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:26 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 24..690 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 24..690 1..667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:16:31 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
CG14573-RA 24..690 1..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21734122..21734788 1..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21734122..21734788 1..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21734122..21734788 1..667 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:16 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21727222..21727888 1..667 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:01 Download gff for MIP13951.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21727222..21727888 1..667 100   Plus

MIP13951.pep Sequence

Translation from 0 to 587

> MIP13951.pep
PTIMARYQFFSSLLLLLAAISAVNCAAQAPLRRTLRLRPVAFARQELAPT
PYPSAAELKPAAEQPALTYGPPEDVDTDALPSEQDPPVDTFEPSPENEEV
DTEESSLEATTPSSAPARLRSRHRLGKLQLAKPKLLRQRTARLEELPVDA
AVAPVASLVPVAQAPALATPQFYYVGAQQPYYLAAYSAAPQQLGW*

MIP13951.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25166-PA 192 GF25166-PA 1..192 4..195 481 70.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16220-PA 191 GG16220-PA 1..191 4..195 756 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16370-PA 187 GH16370-PA 1..187 4..195 378 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14573-PA 192 CG14573-PA 1..192 4..195 971 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11561-PA 191 GI11561-PA 1..191 4..195 383 59.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24858-PA 185 GL24858-PA 16..185 23..195 437 62 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13091-PA 185 GA13091-PA 1..185 4..195 507 63.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22402-PA 192 GM22402-PA 1..192 4..195 797 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14990-PA 69 GD14990-PA 1..69 4..72 321 94.2 Plus
Dsim\GD14991-PA 87 GD14991-PA 4..87 112..195 276 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11241-PA 191 GJ11241-PA 1..191 4..195 376 59.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17060-PA 199 GK17060-PA 1..199 4..195 295 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23032-PA 188 GE23032-PA 1..188 4..195 796 88.5 Plus
Dyak\GE19788-PA 191 GE19788-PA 1..191 4..195 743 89.1 Plus

MIP13951.hyp Sequence

Translation from 0 to 587

> MIP13951.hyp
PTIMARYQFFSSLLLLLAAISAVNCAAQAPLRRTLRLRPVAFARQELAPT
PYPSAAELKPAAEQPALTYGPPEDVDTDALPSEQDPPVDTFEPSPENEEV
DTEESSLEATTPSSAPARLRSRHRLGKLQLAKPKLLRQRTARLEELPVDA
AVAPVASLVPVAQAPALATPQFYYVGAQQPYYLAAYSAAPQQLGW*

MIP13951.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14573-PA 192 CG14573-PA 1..192 4..195 971 100 Plus