Clone MIP13978 Report

Search the DGRC for MIP13978

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:139
Well:78
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG17777-RB
Protein status:MIP13978.pep: gold
Sequenced Size:588

Clone Sequence Records

MIP13978.complete Sequence

588 bp assembled on 2009-10-07

GenBank Submission: BT099967.1

> MIP13978.complete
AACAAACCTCGCCTGGCGCCCTACCCATCAAGTCAACCAGCCAACAGCCA
CTAGCAACATCTGCAGCAGCAACATGAAGTTCTTGTGCGTGTTCGTCATC
CTGGCCATTTGCTTCATGAGCACCTGGGCAGCAGTTTCGGAGCCTGCTCC
TGAAGCTCTGGAGCCGGAGCCATCCGCCGTGGATGAGAAGAAGACGGAGA
AGAGAGGCATCTACGGGTTCGGCCACGGCTATGGCGGCTACGGCGGATAC
GGCGGATACGGTGCCTATGGACACGGTCACTACGGCGGCTACGGTGGACT
GAGCAGTCCCTACTACGGCGGCTACGGATACGTCCATGCGGCGCCCTACT
ACGGCGGACACCACGGCTACTATCCGTACCACCATGGCCACTACGGCTTC
TACTAGGACCACTACCTATCCCCAAGATCGTAATGCATACTGTTTTTTTT
TTCTCGATCGCTCCATGCTCATCACTGCACCATCATTCGTATATGTATAT
GTACTGGTTTTCCCCCATCATTCACCGCAATATAAATGTACTGCAAATAG
CGAATACATTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP13978.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-RB 913 CG17777-RB 230..790 1..561 2805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2081079..2081554 85..560 2365 99.8 Plus
chrX 22417052 chrX 2080788..2080872 1..85 410 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2187147..2187623 85..561 2385 100 Plus
X 23542271 X 2186856..2186940 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2195245..2195721 85..561 2385 100 Plus
X 23527363 X 2194954..2195038 1..85 425 100 Plus
Blast to na_te.dros performed 2019-03-16 01:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2426 26..78 115 73.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6772 25..78 111 72.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6793 42..78 110 81.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6779..6810 42..74 108 84.8 Plus

MIP13978.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:14:56 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2080788..2080872 1..85 98 -> Plus
chrX 2081080..2081554 86..560 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:55 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 1..333 74..406 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:26 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 1..333 74..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:45 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 1..333 74..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:28:35 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 1..333 74..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-07 17:26:29 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 2..407 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:26 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 2..407 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:45 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 2..561 1..560 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:28:35 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 2..561 1..560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:56 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
X 2186856..2186940 1..85 100 -> Plus
X 2187148..2187622 86..560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:56 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
X 2186856..2186940 1..85 100 -> Plus
X 2187148..2187622 86..560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:56 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
X 2186856..2186940 1..85 100 -> Plus
X 2187148..2187622 86..560 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:45 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2080889..2080973 1..85 100 -> Plus
arm_X 2081181..2081655 86..560 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:03 Download gff for MIP13978.complete
Subject Subject Range Query Range Percent Splice Strand
X 2194954..2195038 1..85 100 -> Plus
X 2195246..2195720 86..560 100   Plus

MIP13978.hyp Sequence

Translation from 0 to 405

> MIP13978.hyp
TNLAWRPTHQVNQPTATSNICSSNMKFLCVFVILAICFMSTWAAVSEPAP
EALEPEPSAVDEKKTEKRGIYGFGHGYGGYGGYGGYGAYGHGHYGGYGGL
SSPYYGGYGYVHAAPYYGGHHGYYPYHHGHYGFY*

MIP13978.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-PC 110 CG17777-PC 1..110 25..134 648 100 Plus
CG17777-PB 110 CG17777-PB 1..110 25..134 648 100 Plus
CG13050-PA 143 CG13050-PA 1..123 25..127 160 38.1 Plus
CG9269-PA 146 CG9269-PA 55..119 69..123 158 55.2 Plus
CG17738-PA 110 CG17738-PA 60..105 72..122 147 54.7 Plus
CG9269-PA 146 CG9269-PA 48..123 69..134 140 44.9 Plus

MIP13978.pep Sequence

Translation from 1 to 405

> MIP13978.pep
TNLAWRPTHQVNQPTATSNICSSNMKFLCVFVILAICFMSTWAAVSEPAP
EALEPEPSAVDEKKTEKRGIYGFGHGYGGYGGYGGYGAYGHGHYGGYGGL
SSPYYGGYGYVHAAPYYGGHHGYYPYHHGHYGFY*

MIP13978.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22201-PA 104 GF22201-PA 1..104 25..134 242 71.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12918-PA 110 GG12918-PA 1..110 25..134 528 97.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-PC 110 CG17777-PC 1..110 25..134 648 100 Plus
CG17777-PB 110 CG17777-PB 1..110 25..134 648 100 Plus
CG13050-PA 143 CG13050-PA 1..123 25..127 160 38.1 Plus
CG9269-PA 146 CG9269-PA 55..119 69..123 158 55.2 Plus
CG17738-PA 110 CG17738-PA 60..105 72..122 147 54.7 Plus
CG13721-PA 106 CG13721-PA 7..105 30..134 144 33.3 Plus
CG9269-PA 146 CG9269-PA 48..123 69..134 140 44.9 Plus
CG2157-PA 245 CG2157-PA 30..118 43..126 139 43 Plus
CG2157-PB 247 CG2157-PB 30..118 43..126 139 43 Plus
CG34281-PA 106 CG34281-PA 23..80 73..134 136 43.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15904-PA 109 GI15904-PA 1..109 25..130 170 59.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13327-PA 115 GL13327-PA 1..115 25..134 208 56.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14660-PA 121 GA14660-PA 1..121 25..134 210 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19209-PA 107 GM19209-PA 1..107 25..134 505 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16813-PA 117 GJ16813-PA 1..117 25..134 226 59.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16058-PA 114 GK16058-PA 1..114 25..134 151 58.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16246-PA 111 GE16246-PA 1..111 25..134 345 93.7 Plus