BDGP Sequence Production Resources |
Search the DGRC for MIP13993
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 139 |
Well: | 93 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG32214-RB |
Protein status: | MIP13993.pep: gold |
Sequenced Size: | 436 |
436 bp assembled on 2009-09-28
GenBank Submission: BT099896.1
> MIP13993.complete TTTCACCATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCGTTGCCTGCG CTGCTGCCAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTACACTGCTCCT CTGGCTTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCCGCTCCAGTTGT GACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAATGGAATCGCCG CTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTGCTCCTGTGGTG GCGAAGTACGCGGCTACTCCTCTGGCTGCACCACTGGCCTACTCCTCTCC TTTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTTCAGGACCGCTCC TTATCTAAATTACTAAGCTGTGATCACATCGGAGACAACGATAATAAATG GAGATATAATAAGACGTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32214-RB | 606 | CG32214-RB | 110..528 | 1..419 | 2095 | 100 | Plus |
CG32214.a | 818 | CG32214.a | 110..528 | 1..419 | 2095 | 100 | Plus |
CG12519-RA | 747 | CG12519-RA | 502..698 | 223..419 | 835 | 94.9 | Plus |
CG12519-RA | 747 | CG12519-RA | 328..488 | 76..236 | 670 | 94.4 | Plus |
CG12519-RA | 747 | CG12519-RA | 242..352 | 8..118 | 435 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 19456893..19457291 | 20..418 | 1950 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 19461270..19461529 | 279..20 | 1300 | 100 | Minus |
chr3L | 24539361 | chr3L | 19465384..19465643 | 20..279 | 1285 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 19462281..19462476 | 223..418 | 845 | 95.4 | Plus |
chr3L | 24539361 | chr3L | 19456150..19456374 | 236..30 | 715 | 88.9 | Minus |
chr3L | 24539361 | chr3L | 19462043..19462267 | 30..236 | 700 | 88.4 | Plus |
chr3L | 24539361 | chr3L | 19464646..19464870 | 236..30 | 700 | 88.4 | Minus |
chr3L | 24539361 | chr3L | 19412344..19412723 | 415..45 | 665 | 80.1 | Minus |
chr3L | 24539361 | chr3L | 19476190..19476403 | 402..188 | 620 | 87 | Minus |
chr3L | 24539361 | chr3L | 19467032..19467183 | 418..267 | 550 | 90.8 | Minus |
chr3L | 24539361 | chr3L | 19461136..19461286 | 374..224 | 545 | 90.7 | Minus |
chr3L | 24539361 | chr3L | 19465627..19465777 | 224..374 | 545 | 90.7 | Plus |
chr3L | 24539361 | chr3L | 19413331..19413469 | 79..217 | 485 | 89.9 | Plus |
chr3L | 24539361 | chr3L | 19467855..19467993 | 79..217 | 470 | 89.2 | Plus |
chr3L | 24539361 | chr3L | 19477537..19477680 | 79..231 | 295 | 81 | Plus |
chr3L | 24539361 | chr3L | 19477480..19477558 | 40..118 | 290 | 91.1 | Plus |
chr3L | 24539361 | chr3L | 19414163..19414242 | 132..211 | 265 | 88.8 | Plus |
chr3L | 24539361 | chr3L | 19453846..19453931 | 216..131 | 205 | 82.6 | Minus |
chr3L | 24539361 | chr3L | 19413274..19413329 | 40..95 | 190 | 89.3 | Plus |
chr3L | 24539361 | chr3L | 19467798..19467853 | 40..95 | 190 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CR32205-RA | 1085 | CR32205-RA | 140..278 | 217..79 | 485 | 89.9 | Minus |
pncr009:3L-RA | 961 | CR33940-RA | 807..952 | 256..402 | 470 | 89.1 | Plus |
CR32205-RA | 1085 | CR32205-RA | 793..921 | 202..332 | 335 | 86.2 | Plus |
CR32205-RA | 1085 | CR32205-RA | 935..1008 | 346..419 | 325 | 95.9 | Plus |
CR32205-RA | 1085 | CR32205-RA | 699..817 | 120..238 | 295 | 83.1 | Plus |
CR32205-RA | 1085 | CR32205-RA | 257..335 | 118..40 | 290 | 91.1 | Minus |
pncr009:3L-RA | 961 | CR33940-RA | 266..344 | 118..40 | 275 | 89.8 | Minus |
pncr009:3L-RA | 961 | CR33940-RA | 202..287 | 164..79 | 235 | 84.8 | Minus |
pncr009:3L-RA | 961 | CR33940-RA | 144..202 | 231..173 | 190 | 88.1 | Minus |
pncr009:3L-RA | 961 | CR33940-RA | 739..790 | 188..239 | 185 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 19467471..19467870 | 20..419 | 2000 | 100 | Plus |
3L | 28110227 | 3L | 19471847..19472106 | 279..20 | 1300 | 100 | Minus |
3L | 28110227 | 3L | 19475961..19476220 | 20..279 | 1270 | 99.2 | Plus |
3L | 28110227 | 3L | 19472858..19473054 | 223..419 | 835 | 94.9 | Plus |
3L | 28110227 | 3L | 19472620..19472844 | 30..236 | 700 | 88.4 | Plus |
3L | 28110227 | 3L | 19475223..19475447 | 236..30 | 700 | 88.4 | Minus |
3L | 28110227 | 3L | 19422915..19423298 | 419..45 | 685 | 80.3 | Minus |
3L | 28110227 | 3L | 19466728..19466952 | 236..30 | 685 | 88 | Minus |
3L | 28110227 | 3L | 19486755..19486968 | 402..188 | 590 | 86 | Minus |
3L | 28110227 | 3L | 19476204..19476354 | 224..374 | 545 | 90.7 | Plus |
3L | 28110227 | 3L | 19471713..19471863 | 374..224 | 545 | 90.7 | Minus |
3L | 28110227 | 3L | 19477608..19477760 | 419..267 | 540 | 90.2 | Minus |
3L | 28110227 | 3L | 19423906..19424044 | 79..217 | 485 | 89.9 | Plus |
3L | 28110227 | 3L | 19478430..19478568 | 79..217 | 485 | 89.9 | Plus |
3L | 28110227 | 3L | 19488102..19488245 | 79..231 | 295 | 81 | Plus |
3L | 28110227 | 3L | 19488045..19488123 | 40..118 | 275 | 89.9 | Plus |
3L | 28110227 | 3L | 19424757..19424836 | 132..211 | 265 | 88.8 | Plus |
3L | 28110227 | 3L | 19464433..19464518 | 216..131 | 205 | 82.6 | Minus |
3L | 28110227 | 3L | 19478373..19478428 | 40..95 | 205 | 91.1 | Plus |
3L | 28110227 | 3L | 19423849..19423904 | 40..95 | 190 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 19460571..19460970 | 20..419 | 2000 | 100 | Plus |
3L | 28103327 | 3L | 19464947..19465206 | 279..20 | 1300 | 100 | Minus |
3L | 28103327 | 3L | 19469061..19469320 | 20..279 | 1270 | 99.2 | Plus |
3L | 28103327 | 3L | 19465958..19466154 | 223..419 | 835 | 94.9 | Plus |
3L | 28103327 | 3L | 19465784..19465944 | 76..236 | 670 | 94.4 | Plus |
3L | 28103327 | 3L | 19468323..19468483 | 236..76 | 670 | 94.4 | Minus |
3L | 28103327 | 3L | 19459828..19459988 | 236..76 | 655 | 93.7 | Minus |
3L | 28103327 | 3L | 19469304..19469454 | 224..374 | 545 | 90.7 | Plus |
3L | 28103327 | 3L | 19464813..19464963 | 374..224 | 545 | 90.7 | Minus |
3L | 28103327 | 3L | 19470708..19470860 | 419..267 | 540 | 90.1 | Minus |
3L | 28103327 | 3L | 19417006..19417144 | 79..217 | 485 | 89.9 | Plus |
3L | 28103327 | 3L | 19471530..19471668 | 79..217 | 485 | 89.9 | Plus |
3L | 28103327 | 3L | 19479855..19480000 | 402..256 | 470 | 89.1 | Minus |
3L | 28103327 | 3L | 19465720..19465808 | 30..118 | 400 | 96.6 | Plus |
3L | 28103327 | 3L | 19468459..19468547 | 118..30 | 400 | 96.6 | Minus |
3L | 28103327 | 3L | 19459964..19460052 | 118..30 | 400 | 96.6 | Minus |
3L | 28103327 | 3L | 19416102..19416230 | 332..202 | 335 | 86.2 | Minus |
3L | 28103327 | 3L | 19416015..19416088 | 419..346 | 325 | 95.9 | Minus |
3L | 28103327 | 3L | 19471473..19471551 | 40..118 | 305 | 92.4 | Plus |
3L | 28103327 | 3L | 19416206..19416324 | 238..120 | 295 | 83.1 | Minus |
3L | 28103327 | 3L | 19416949..19417027 | 40..118 | 290 | 91.1 | Plus |
3L | 28103327 | 3L | 19481145..19481223 | 40..118 | 275 | 89.8 | Plus |
3L | 28103327 | 3L | 19417857..19417936 | 132..211 | 265 | 88.7 | Plus |
3L | 28103327 | 3L | 19481202..19481287 | 79..164 | 235 | 84.8 | Plus |
3L | 28103327 | 3L | 19457533..19457618 | 216..131 | 205 | 82.5 | Minus |
3L | 28103327 | 3L | 19481287..19481345 | 173..231 | 190 | 88.1 | Plus |
3L | 28103327 | 3L | 19480017..19480068 | 239..188 | 185 | 90.3 | Minus |
3L | 28103327 | 3L | 19468253..19468309 | 279..223 | 165 | 85.9 | Minus |
3L | 28103327 | 3L | 19417811..19417863 | 47..99 | 160 | 86.7 | Plus |
3L | 28103327 | 3L | 19470855..19470926 | 116..45 | 150 | 80.5 | Minus |
3L | 28103327 | 3L | 19468223..19468270 | 270..223 | 150 | 87.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19456815..19456833 | 1..19 | 100 | -> | Plus |
chr3L | 19456893..19457291 | 20..418 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 1..351 | 8..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 1..351 | 8..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 1..351 | 8..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 1..351 | 8..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
825-Oak-RB | 45..325 | 1..281 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 45..462 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 48..465 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32214-RB | 48..465 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19467393..19467411 | 1..19 | 100 | -> | Plus |
3L | 19467471..19467869 | 20..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19467393..19467411 | 1..19 | 100 | -> | Plus |
3L | 19467471..19467869 | 20..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19467393..19467411 | 1..19 | 100 | -> | Plus |
3L | 19467471..19467869 | 20..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19460493..19460511 | 1..19 | 100 | -> | Plus |
arm_3L | 19460571..19460969 | 20..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19460571..19460969 | 20..418 | 100 | Plus | |
3L | 19460493..19460511 | 1..19 | 100 | -> | Plus |
Translation from 0 to 357
> MIP13993.hyp FTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVV TATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPLAYSSP LAYSAPLSYAAASGPLLI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32214-PC | 116 | CG32214-PC | 1..116 | 3..118 | 562 | 100 | Plus |
CG32214-PB | 116 | CG32214-PB | 1..116 | 3..118 | 562 | 100 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..129 | 3..118 | 523 | 87.6 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..129 | 3..118 | 520 | 86.8 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..131 | 3..118 | 498 | 84 | Plus |
Translation from 1 to 357
> MIP13993.pep FTMFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVV TATSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPLAYSSP LAYSAPLSYAAASGPLLI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23675-PA | 108 | GF23675-PA | 1..100 | 3..111 | 260 | 66.1 | Plus |
Dana\GF23676-PA | 120 | GF23676-PA | 1..120 | 3..118 | 231 | 75.2 | Plus |
Dana\GF10759-PA | 139 | GF10759-PA | 1..137 | 3..101 | 218 | 65 | Plus |
Dana\GF23674-PA | 140 | GF23674-PA | 1..140 | 3..118 | 199 | 67.4 | Plus |
Dana\GF23677-PA | 132 | GF23677-PA | 1..111 | 3..86 | 190 | 67.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13407-PA | 135 | GG13407-PA | 1..135 | 3..118 | 312 | 67.4 | Plus |
Dere\GG13406-PA | 105 | GG13406-PA | 1..105 | 3..118 | 311 | 75.8 | Plus |
Dere\GG16035-PA | 121 | GG16035-PA | 1..121 | 3..118 | 301 | 67.6 | Plus |
Dere\GG16037-PA | 134 | GG16037-PA | 1..134 | 3..118 | 158 | 65.9 | Plus |
Dere\GG13408-PA | 155 | GG13408-PA | 43..140 | 20..111 | 151 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24646-PA | 120 | GH24646-PA | 1..120 | 3..118 | 214 | 67.7 | Plus |
Dgri\GH22597-PA | 126 | GH22597-PA | 1..126 | 3..118 | 206 | 66.9 | Plus |
Dgri\GH22599-PA | 120 | GH22599-PA | 1..120 | 3..118 | 197 | 64.6 | Plus |
Dgri\GH22596-PA | 120 | GH22596-PA | 1..120 | 3..118 | 197 | 64.6 | Plus |
Dgri\GH22595-PA | 129 | GH22595-PA | 1..97 | 3..96 | 196 | 55.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32214-PC | 116 | CG32214-PC | 1..116 | 3..118 | 562 | 100 | Plus |
CG32214-PB | 116 | CG32214-PB | 1..116 | 3..118 | 562 | 100 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..129 | 3..118 | 523 | 87.6 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..129 | 3..118 | 520 | 86.8 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..131 | 3..118 | 498 | 84 | Plus |
CG12519-PA | 131 | CG12519-PA | 1..131 | 3..118 | 498 | 84 | Plus |
CG18294-PA | 141 | CG18294-PA | 1..141 | 3..118 | 429 | 71.6 | Plus |
CG14096-PA | 122 | CG14096-PA | 1..122 | 3..118 | 418 | 74.6 | Plus |
CG32212-PA | 111 | CG32212-PA | 1..111 | 3..118 | 299 | 64.8 | Plus |
CG14095-PA | 162 | CG14095-PA | 1..113 | 3..117 | 294 | 57.4 | Plus |
CG13678-PA | 128 | CG13678-PA | 1..126 | 3..118 | 217 | 49.2 | Plus |
CG13679-PB | 119 | CG13679-PB | 5..117 | 7..118 | 195 | 50.9 | Plus |
CG13068-PA | 109 | CG13068-PA | 1..98 | 3..111 | 190 | 50.4 | Plus |
CG13674-PB | 137 | CG13674-PB | 5..135 | 7..118 | 182 | 43 | Plus |
CG13674-PA | 137 | CG13674-PA | 5..135 | 7..118 | 182 | 43 | Plus |
CG13047-PB | 170 | CG13047-PB | 1..120 | 3..116 | 175 | 43.8 | Plus |
CG13044-PA | 155 | CG13044-PA | 1..143 | 3..117 | 171 | 40.7 | Plus |
CG13069-PA | 97 | CG13069-PA | 1..93 | 3..107 | 163 | 45.5 | Plus |
Cpr64Ad-PB | 247 | CG1259-PB | 49..137 | 21..113 | 152 | 47.4 | Plus |
CG13049-PA | 181 | CG13049-PA | 75..176 | 12..115 | 148 | 42.5 | Plus |
CG13049-PA | 181 | CG13049-PA | 2..111 | 6..115 | 137 | 38.8 | Plus |
CG13066-PB | 93 | CG13066-PB | 5..88 | 6..96 | 135 | 44.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11789-PA | 104 | GI11789-PA | 1..99 | 3..106 | 266 | 69.2 | Plus |
Dmoj\GI13530-PA | 164 | GI13530-PA | 34..164 | 2..118 | 194 | 62.8 | Plus |
Dmoj\GI11787-PA | 161 | GI11787-PA | 1..62 | 3..72 | 145 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20932-PA | 139 | GL20932-PA | 1..125 | 3..109 | 216 | 59.5 | Plus |
Dper\GL20934-PA | 62 | GL20934-PA | 1..55 | 3..63 | 159 | 60.7 | Plus |
Dper\GL20898-PA | 151 | GL20898-PA | 1..147 | 3..111 | 135 | 42 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28229-PA | 126 | GA28229-PA | 1..112 | 3..109 | 182 | 72.9 | Plus |
Dpse\GA28232-PA | 151 | GA28232-PA | 1..147 | 3..111 | 159 | 41.4 | Plus |
Dpse\GA28633-PA | 187 | GA28633-PA | 1..56 | 3..64 | 156 | 75.8 | Plus |
Dpse\GA28633-PA | 187 | GA28633-PA | 90..185 | 7..107 | 152 | 80.4 | Plus |
Dpse\GA28230-PA | 131 | GA28230-PA | 11..127 | 1..111 | 143 | 68.9 | Plus |
Dpse\GA28228-PA | 131 | GA28228-PA | 11..127 | 1..111 | 143 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19525-PA | 182 | GM19525-PA | 93..182 | 42..118 | 212 | 72.2 | Plus |
Dsec\GM18729-PA | 154 | GM18729-PA | 1..65 | 3..74 | 147 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14802-PA | 179 | GD14802-PA | 35..128 | 2..95 | 408 | 96.8 | Plus |
Dsim\GD12281-PA | 135 | GD12281-PA | 1..118 | 3..109 | 217 | 84.7 | Plus |
Dsim\GD14804-PA | 151 | GD14804-PA | 35..151 | 2..118 | 209 | 94.9 | Plus |
Dsim\GD12284-PA | 170 | GD12284-PA | 35..170 | 2..118 | 200 | 80.1 | Plus |
Dsim\GD12282-PA | 154 | GD12282-PA | 1..78 | 3..88 | 135 | 62.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13492-PA | 122 | GJ13492-PA | 1..92 | 3..95 | 174 | 72.3 | Plus |
Dvir\GJ13493-PA | 110 | GJ13493-PA | 1..103 | 3..106 | 160 | 73.3 | Plus |
Dvir\GJ11892-PA | 119 | GJ11892-PA | 1..119 | 3..118 | 160 | 65.3 | Plus |
Dvir\GJ13490-PA | 140 | GJ13490-PA | 1..54 | 3..64 | 140 | 67.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20211-PA | 128 | GK20211-PA | 1..128 | 3..118 | 203 | 55.8 | Plus |
Dwil\GK20201-PA | 138 | GK20201-PA | 1..138 | 3..118 | 196 | 51 | Plus |
Dwil\GK20194-PA | 142 | GK20194-PA | 1..126 | 3..109 | 196 | 55.3 | Plus |
Dwil\GK19523-PA | 137 | GK19523-PA | 1..133 | 3..112 | 194 | 52.4 | Plus |
Dwil\GK19490-PA | 142 | GK19490-PA | 1..126 | 3..109 | 190 | 52.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23008-PA | 147 | GE23008-PA | 25..147 | 2..118 | 242 | 82.1 | Plus |
Dyak\GE15121-PA | 142 | GE15121-PA | 25..142 | 2..118 | 230 | 81.4 | Plus |
Dyak\GE22502-PA | 117 | GE22502-PA | 1..107 | 3..109 | 207 | 83.2 | Plus |
Dyak\GE23069-PA | 145 | GE23069-PA | 25..145 | 2..118 | 177 | 79.3 | Plus |
Dyak\GE22779-PA | 124 | GE22779-PA | 1..109 | 3..111 | 153 | 85.3 | Plus |