Clone MIP14036 Report

Search the DGRC for MIP14036

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:140
Well:36
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34293-RA
Protein status:MIP14036.pep: gold
Sequenced Size:741

Clone Sequence Records

MIP14036.complete Sequence

741 bp assembled on 2009-10-23

GenBank Submission: BT100160.1

> MIP14036.complete
CGCGATTTTATTGGACTTTAGTCATTGAAAATGTTAAATTTAAAACACTT
TGCCAGCCACGCCTACCGCCAGTACGAACTGGTGACGTGCGTGAACATGC
TGGAGCCCTGGGAAAAGAAGCTGATCAATGGATTCTTTCTGGTGATGCTG
CTCCTGGTGCTCTTCTCCAGCTTCATGTATCTTCCCAACTACATGCAAAC
CCTAATGCAATTTGTAACGCCGCCCAACTGGCACAATTCCCCGGATAGCG
CAGCCTATGTGGCACAAAAGATCGCACGGAGCTGAGCTCCTACTACCAAC
TTCGTACAAGTGCATACTCCCTATAGAAAGACAACTATGATTTAAAGCTT
ATAATATTATTGTGATTTACGTCGACTGGTCCAAGATCTACAGATAACAA
TGGTCTCCACTATTCGCAAGGCGGATGTGTTGAAGAACAGGCCAACCAGT
CCTCCAAGGGAAACTGAAAAGGCGGAATTGAATTCGAAACTATTATATAT
ATGGATAGCGTAGCTTACTCAAGAAGTCCAGTATAGTCTTGGTTACGCGA
CGAACGTATCGTTGTGTTGGCAGTTCAACCAAGGCCACGCGGATTTCGGA
CACTTCATCTGAGGCTTCATCATCCCTTAAAGTTAAAAGATACATTTTTA
AGTAGCCCATTTACTTATTTCAACTCTCAATGTTAAATTGTGCAAATGAA
ACATCCTAATGTGCTTACTCATCAAAAAAAAAAAAAAAAAA

MIP14036.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293.a 613 CG34293.a 95..613 1..519 2595 100 Plus
CG34293-RA 541 CG34293-RA 95..483 1..389 1945 100 Plus
CG31065-RB 1266 CG31065-RB 996..1102 625..519 535 100 Minus
CG31065-RB 1266 CG31065-RB 1103..1176 463..390 370 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22987734..22988067 723..390 1625 99.1 Minus
chr3R 27901430 chr3R 22988135..22988396 389..128 1295 99.6 Minus
chr3R 27901430 chr3R 22988458..22988584 127..1 605 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27164707..27165041 724..390 1675 100 Minus
3R 32079331 3R 27165109..27165370 389..128 1310 100 Minus
3R 32079331 3R 27165432..27165558 127..1 635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26905538..26905872 724..390 1675 100 Minus
3R 31820162 3R 26905940..26906201 389..128 1310 100 Minus
3R 31820162 3R 26906263..26906389 127..1 635 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:48:12 has no hits.

MIP14036.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:49:16 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22987734..22988067 390..723 99 <- Minus
chr3R 22988135..22988396 128..389 99 <- Minus
chr3R 22988458..22988584 1..127 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-23 10:50:47 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 1..255 31..285 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:33 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 1..255 31..285 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:43 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 1..255 31..285 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:54:41 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 1..255 31..285 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-23 10:50:46 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 18..413 1..396 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:33 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 18..413 1..396 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:43 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RB 18..740 1..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:54:41 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RB 18..740 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:16 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27164708..27165041 390..723 100 <- Minus
3R 27165109..27165370 128..389 100 <- Minus
3R 27165432..27165558 1..127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:16 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27164708..27165041 390..723 100 <- Minus
3R 27165109..27165370 128..389 100 <- Minus
3R 27165432..27165558 1..127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:16 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27164708..27165041 390..723 100 <- Minus
3R 27165109..27165370 128..389 100 <- Minus
3R 27165432..27165558 1..127 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:43 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22990430..22990763 390..723 100 <- Minus
arm_3R 22990831..22991092 128..389 100 <- Minus
arm_3R 22991154..22991280 1..127 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:34 Download gff for MIP14036.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26905539..26905872 390..723 100 <- Minus
3R 26905940..26906201 128..389 100 <- Minus
3R 26906263..26906389 1..127 100   Minus

MIP14036.hyp Sequence

Translation from 30 to 284

> MIP14036.hyp
MLNLKHFASHAYRQYELVTCVNMLEPWEKKLINGFFLVMLLLVLFSSFMY
LPNYMQTLMQFVTPPNWHNSPDSAAYVAQKIARS*

MIP14036.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-PB 84 CG34293-PB 1..84 1..84 447 100 Plus
CG34293-PA 84 CG34293-PA 1..84 1..84 447 100 Plus

MIP14036.pep Sequence

Translation from 30 to 284

> MIP14036.pep
MLNLKHFASHAYRQYELVTCVNMLEPWEKKLINGFFLVMLLLVLFSSFMY
LPNYMQTLMQFVTPPNWHNSPDSAAYVAQKIARS*

MIP14036.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12135-PA 84 GG12135-PA 1..84 1..84 419 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-PB 84 CG34293-PB 1..84 1..84 447 100 Plus
CG34293-PA 84 CG34293-PA 1..84 1..84 447 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10496-PA 84 GI10496-PA 1..82 1..82 260 57.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23609-PA 84 GL23609-PA 1..84 1..84 312 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26657-PA 84 GA26657-PA 1..84 1..84 329 70.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10128-PA 84 GM10128-PA 1..84 1..84 427 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18090-PA 84 GD18090-PA 1..84 1..84 427 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23177-PA 62 GJ23177-PA 1..60 23..82 168 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11193-PA 85 GK11193-PA 1..84 1..84 301 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10582-PA 84 GE10582-PA 1..84 1..84 411 91.7 Plus