Clone MIP14040 Report

Search the DGRC for MIP14040

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:140
Well:40
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34433-RB
Protein status:MIP14040.pep: gold
Sequenced Size:853

Clone Sequence Records

MIP14040.complete Sequence

853 bp assembled on 2009-11-04

GenBank Submission: BT100251.1

> MIP14040.complete
TTTTGTAATGTCTGGAGCGGAGTCCCTTTTTACTTGGGTGTACGGACCGG
GTGTCACGCGAGGGGGCAGTGTGGTGGGGCATCATCAGCCCGAGGCCCTG
CGACCCGTGCTCTTTCTGTTCTATACCCTGGAAACCATCTTCAACATGTT
CTGCATGGGATATCACATCTCGGGCTTTCAGGCCATCGAATTGCATGTGT
TCGAATGGGATACGAGCGTCAATATATGCACAGGTAACACACCCGCCGTC
GTCACGGAGATCTGGAAGTCCTCGGCGGCAGCCATCGTCTTTATCCTGAT
ATCCTTGAGCACAATGTGGGACGCGGAGCGGCAGTTTTACGTGTTCTTTT
TTGCGAGCGAGCTTGGCGATAAGAATTCACATGCATTTGTGGAAGACCGC
CCAATACACCCGATCTTCCACTACCTTCGTGGTATGTCCATCTCCTCGCT
GACCTGCGGAATACTCTACCTGCTGCACGCCACTATCATGATCGACGTCA
AGCTTACCAATGACCGGAACCAAGGAGAGAGCAAGGGTACCTATATGCCC
ATACCTCTTTTCGTCCTGGGGCGATTCATCCACAGGAAACTAAGCGCCTA
CGATTGGTTTCGGGAGTTCTGCGAGAACGATATCATTTACTTGTAGCCGG
ATTCTCGGAACATTTATTCAATGCTTCAAATTTATTCAAATTGCAGTTTC
ACATTTTTAAATATCGCACTTTCTAAATTTTGTAAGTAATTGGTTGATGT
ATTCATAATGAATATGAAATGTATACTTTTATAAGCAATACTTCAATCTG
TAATCAGTAAAGCTTTTCCAATTCGTTATGTAGTTAAAAAAAAAAAAAAA
AAA

MIP14040.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433.a 824 CG34433.a 35..824 1..790 3950 100 Plus
CG34433-RA 702 CG34433-RA 270..702 214..646 2165 100 Plus
CG34433-RA 702 CG34433-RA 1..207 8..214 1035 100 Plus
CG34432-RA 732 CG34432-RA 286..378 256..348 195 80.6 Plus
CG34432-RA 732 CG34432-RA 91..171 109..189 165 80.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26472776..26473386 214..824 2920 98.5 Plus
chr3R 27901430 chr3R 26472500..26472713 1..214 1055 99.5 Plus
chr3R 27901430 chr3R 26471969..26472061 256..348 195 80.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30650237..30650860 214..837 3120 100 Plus
3R 32079331 3R 30649961..30650174 1..214 1070 100 Plus
3R 32079331 3R 30649430..30649522 256..348 195 80.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30391068..30391691 214..837 3120 100 Plus
3R 31820162 3R 30390792..30391005 1..214 1070 100 Plus
3R 31820162 3R 30390261..30390353 256..348 195 80.6 Plus
3R 31820162 3R 30390066..30390146 109..189 165 80.2 Plus
Blast to na_te.dros performed 2019-03-16 20:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
looper1 1881 looper1 LOOPER1_DM 1881bp 1618..1721 829..729 115 61.9 Minus

MIP14040.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:47:25 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26472500..26472713 1..214 99 -> Plus
chr3R 26472777..26473395 215..835 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-04 10:04:04 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RA 1..207 8..214 100 -> Plus
CG34433-RA 271..702 215..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:17:23 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:58 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:16 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..639 8..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-04 10:04:03 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RA 1..207 8..214 100 -> Plus
CG34433-RA 271..702 215..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:17:22 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:58 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..835 1..835 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:16 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 1..835 1..835 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:25 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649961..30650174 1..214 100 -> Plus
3R 30650238..30650858 215..835 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:25 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649961..30650174 1..214 100 -> Plus
3R 30650238..30650858 215..835 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:47:25 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649961..30650174 1..214 100 -> Plus
3R 30650238..30650858 215..835 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:58 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26475683..26475896 1..214 100 -> Plus
arm_3R 26475960..26476580 215..835 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:06:53 Download gff for MIP14040.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30390792..30391005 1..214 100 -> Plus
3R 30391069..30391689 215..835 100   Plus

MIP14040.hyp Sequence

Translation from 0 to 645

> MIP14040.hyp
FVMSGAESLFTWVYGPGVTRGGSVVGHHQPEALRPVLFLFYTLETIFNMF
CMGYHISGFQAIELHVFEWDTSVNICTGNTPAVVTEIWKSSAAAIVFILI
SLSTMWDAERQFYVFFFASELGDKNSHAFVEDRPIHPIFHYLRGMSISSL
TCGILYLLHATIMIDVKLTNDRNQGESKGTYMPIPLFVLGRFIHRKLSAY
DWFREFCENDIIYL*

MIP14040.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433-PB 212 CG34433-PB 1..212 3..214 1136 100 Plus
CG34433-PA 233 CG34433-PA 1..233 3..214 1104 91 Plus
CG34432-PA 213 CG34432-PA 16..211 29..212 499 51.5 Plus
CG14315-PA 217 CG14315-PA 8..214 33..211 295 29.4 Plus

MIP14040.pep Sequence

Translation from 1 to 645

> MIP14040.pep
FVMSGAESLFTWVYGPGVTRGGSVVGHHQPEALRPVLFLFYTLETIFNMF
CMGYHISGFQAIELHVFEWDTSVNICTGNTPAVVTEIWKSSAAAIVFILI
SLSTMWDAERQFYVFFFASELGDKNSHAFVEDRPIHPIFHYLRGMSISSL
TCGILYLLHATIMIDVKLTNDRNQGESKGTYMPIPLFVLGRFIHRKLSAY
DWFREFCENDIIYL*

MIP14040.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16758-PA 218 GF16758-PA 8..210 33..206 273 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11769-PA 359 GG11769-PA 144..359 20..214 799 69.4 Plus
Dere\GG11769-PA 359 GG11769-PA 16..148 29..147 299 48.1 Plus
Dere\GG22659-PA 217 GG22659-PA 8..214 33..211 270 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15090-PA 207 GH15090-PA 1..205 33..212 298 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433-PB 212 CG34433-PB 1..212 3..214 1136 100 Plus
CG34433-PA 233 CG34433-PA 1..233 3..214 1104 91 Plus
CG34432-PA 213 CG34432-PA 16..211 29..212 499 51.5 Plus
CG14315-PA 217 CG14315-PA 8..214 33..211 295 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22116-PA 223 GI22116-PA 22..221 33..212 447 45.6 Plus
Dmoj\GI23715-PA 204 GI23715-PA 1..202 33..212 277 32.2 Plus
Dmoj\GI23716-PA 203 GI23716-PA 1..195 33..206 179 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13511-PA 163 GL13511-PA 14..158 32..156 360 49.3 Plus
Dper\GL12591-PA 211 GL12591-PA 1..206 33..209 341 34.4 Plus
Dper\GL12590-PA 207 GL12590-PA 2..199 33..206 302 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26877-PA 218 GA26877-PA 14..216 32..212 521 51 Plus
Dpse\GA12902-PA 211 GA12902-PA 1..206 33..209 334 33.5 Plus
Dpse\GA27567-PA 207 GA27567-PA 2..199 33..206 297 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12899-PA 381 GM12899-PA 145..329 21..186 777 80.7 Plus
Dsec\GM12899-PA 381 GM12899-PA 16..148 29..147 303 48.9 Plus
Dsec\GM15279-PA 217 GM15279-PA 8..212 33..209 302 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21538-PA 359 GD21538-PA 145..359 21..214 966 85.1 Plus
Dsim\GD21538-PA 359 GD21538-PA 16..148 29..147 302 48.9 Plus
Dsim\GD19203-PA 217 GD19203-PA 8..212 33..209 297 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24236-PA 221 GJ24236-PA 1..219 18..212 456 41 Plus
Dvir\GJ24238-PA 209 GJ24238-PA 7..207 32..212 431 42 Plus
Dvir\GJ23274-PA 208 GJ23274-PA 1..200 33..206 306 35 Plus
Dvir\GJ24234-PA 109 GJ24234-PA 1..107 105..212 228 40.5 Plus
Dvir\GJ24235-PA 109 GJ24235-PA 1..102 105..207 228 41.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14150-PA 228 GK14150-PA 25..228 32..214 518 44.9 Plus
Dwil\GK18883-PA 209 GK18883-PA 1..205 33..210 351 34.6 Plus
Dwil\GK19182-PA 211 GK19182-PA 4..206 32..209 329 35.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10896-PA 399 GE10896-PA 145..329 20..183 603 62.7 Plus
Dyak\GE10896-PA 399 GE10896-PA 14..148 27..146 304 47.1 Plus
Dyak\GE25513-PA 217 GE25513-PA 8..214 33..211 279 30.8 Plus