Clone MIP14063 Report

Search the DGRC for MIP14063

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:140
Well:63
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG7548-RA
Protein status:MIP14063.pep: gold
Sequenced Size:695

Clone Sequence Records

MIP14063.complete Sequence

695 bp assembled on 2011-03-17

GenBank Submission: BT126224.1

> MIP14063.complete
AATTGCTCCAATCGACATGGCTTACTTCCAGTTCCTCAGCGTTGCCTCCA
GCTTGCTTCTACTCCTGGCTCCCACCTGGGCAGGTCTGATTGCTCAGCCG
ACCATCACCTATGCTGGCAATGAGCACGCGGTGGCCCACACCCAACAGAA
TGTAGTAAGGAGCTTCGATGGCACCGTCTCCCACTACGCCAAGTCGCTGG
CCACGCCCTACTCGCAGGTCCACAAGCAGGACACGCGGATCAGCAACAAT
GTCTACCAGCCGGCTGTGGCCAAGACCTTCAGTTATGCTACAGCTCCAGC
TCCGGTTTACACGCACCAGGCTCATCAGGAACCAAAAAATCTGTTTACTC
AGGCATCGCCAGTTTACCAGCAGGATGCTCATGTCCAGACTCCATCGGTT
TACCAGCAGGCTGCTCATGTCCAGACTCCATCGGTTTACCATCAGCCCGC
TCAGGTGCAGAGCTACCACCAACCTGGTCATGTGGAGGCACCTTCTGTTT
ACCAACAGAACGCCCACTACAGCCACCAGCCTGCTGTCATCCACTATTCT
CCGGCGGAGACCGTCTCCCACATGAGCTTCGATGGTTTCGGTACCCACTA
CGGATTTTAAGTGATCAATACTTAAGTTAAGATTATAAAGAATAGCTTGT
GTATGCTTGTTAAATAAATTGTTGAACTAAAAAAAAAAAAAAAAA

MIP14063.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7497614..7498291 678..1 3240 98.5 Minus
chr3L 24539361 chr3L 7497867..7497930 461..398 245 92.2 Minus
chr3L 24539361 chr3L 7497831..7497894 425..362 230 90.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7505536..7506217 682..1 3395 99.9 Minus
3L 28110227 3L 7505757..7505820 425..362 230 90.6 Minus
3L 28110227 3L 7505793..7505856 461..398 230 90.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7498636..7499317 682..1 3395 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 22:31:07 has no hits.

MIP14063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:32:05 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7497614..7498291 1..678 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:39:22 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..594 17..610 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:56:34 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..594 17..610 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:28:51 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..594 17..610 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:39:21 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..678 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:56:34 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..678 1..678 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:28:51 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
CG7548-RA 1..678 1..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:05 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7505540..7506217 1..678 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:05 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7505540..7506217 1..678 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:05 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7505540..7506217 1..678 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:56:34 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7498640..7499317 1..678 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:20 Download gff for MIP14063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7498640..7499317 1..678 99   Minus

MIP14063.hyp Sequence

Translation from 0 to 609

> MIP14063.hyp
IAPIDMAYFQFLSVASSLLLLLAPTWAGLIAQPTITYAGNEHAVAHTQQN
VVRSFDGTVSHYAKSLATPYSQVHKQDTRISNNVYQPAVAKTFSYATAPA
PVYTHQAHQEPKNLFTQASPVYQQDAHVQTPSVYQQAAHVQTPSVYHQPA
QVQSYHQPGHVEAPSVYQQNAHYSHQPAVIHYSPAETVSHMSFDGFGTHY
GF*

MIP14063.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7548-PA 197 CG7548-PA 1..197 6..202 1049 100 Plus
CG8543-PA 219 CG8543-PA 8..219 6..202 320 39.7 Plus
CG8541-PA 275 CG8541-PA 8..275 17..202 303 34.8 Plus

MIP14063.pep Sequence

Translation from 1 to 609

> MIP14063.pep
IAPIDMAYFQFLSVASSLLLLLAPTWAGLIAQPTITYAGNEHAVAHTQQN
VVRSFDGTVSHYAKSLATPYSQVHKQDTRISNNVYQPAVAKTFSYATAPA
PVYTHQAHQEPKNLFTQASPVYQQDAHVQTPSVYQQAAHVQTPSVYHQPA
QVQSYHQPGHVEAPSVYQQNAHYSHQPAVIHYSPAETVSHMSFDGFGTHY
GF*

MIP14063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23782-PA 193 GF23782-PA 3..193 10..202 611 71.1 Plus
Dana\GF10648-PA 302 GF10648-PA 9..153 18..152 243 45.8 Plus
Dana\GF23787-PA 217 GF23787-PA 6..217 4..202 210 36.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14954-PA 230 GG14954-PA 1..230 6..202 781 78.3 Plus
Dere\GG14957-PA 246 GG14957-PA 6..246 4..202 245 35.4 Plus
Dere\GG14433-PA 275 GG14433-PA 3..148 9..168 235 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16609-PA 182 GH16609-PA 24..182 35..202 383 58.9 Plus
Dgri\GH16612-PA 223 GH16612-PA 1..223 9..202 239 36.2 Plus
Dgri\GH14888-PA 287 GH14888-PA 3..173 9..188 214 40.9 Plus
Dgri\GH22234-PA 171 GH22234-PA 1..171 53..202 184 35.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7548-PA 197 CG7548-PA 1..197 6..202 1049 100 Plus
CG8543-PA 219 CG8543-PA 8..219 6..202 320 39.7 Plus
CG8541-PA 275 CG8541-PA 8..275 17..202 303 34.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12454-PA 161 GI12454-PA 17..161 24..202 375 54.6 Plus
Dmoj\GI12865-PA 254 GI12865-PA 8..254 17..202 278 35.9 Plus
Dmoj\GI12457-PA 198 GI12457-PA 22..198 22..202 221 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24198-PA 189 GL24198-PA 4..189 10..202 578 69.5 Plus
Dper\GL26496-PA 255 GL26496-PA 3..255 9..202 264 38 Plus
Dper\GL24242-PA 196 GL24242-PA 3..196 11..202 229 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20430-PA 202 GA20430-PA 4..202 10..202 574 67.5 Plus
Dpse\GA21149-PA 255 GA21149-PA 3..255 9..202 262 36.5 Plus
Dpse\GA21151-PA 220 GA21151-PA 1..220 9..202 246 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13752-PA 193 GM13752-PA 1..187 6..185 578 75.4 Plus
Dsec\GM13755-PA 203 GM13755-PA 6..203 4..202 224 36.7 Plus
Dsec\GM14848-PA 275 GM14848-PA 3..138 9..156 224 43.2 Plus
Dsec\GM14848-PA 275 GM14848-PA 186..275 97..202 145 41.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13051-PA 215 GD13051-PA 1..215 6..202 891 87 Plus
Dsim\GD14020-PA 263 GD14020-PA 3..138 9..156 226 43.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12355-PA 154 GJ12355-PA 16..154 24..202 433 58.1 Plus
Dvir\GJ13007-PA 259 GJ13007-PA 28..259 30..202 277 38.2 Plus
Dvir\GJ12359-PA 175 GJ12359-PA 1..175 9..202 239 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16801-PA 169 GK16801-PA 4..169 10..202 447 55.1 Plus
Dwil\GK17387-PA 270 GK17387-PA 3..270 9..202 273 37.3 Plus
Dwil\GK16804-PA 214 GK16804-PA 41..214 43..202 231 39.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20405-PA 227 GE20405-PA 1..227 6..202 792 79.3 Plus
Dyak\GE21623-PA 256 GE21623-PA 3..256 9..202 250 35.1 Plus
Dyak\GE20408-PA 234 GE20408-PA 6..234 4..202 243 37.7 Plus