Clone MIP14068 Report

Search the DGRC for MIP14068

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:140
Well:68
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCheA7a-RA
Protein status:MIP14068.pep: gold
Sequenced Size:747

Clone Sequence Records

MIP14068.complete Sequence

747 bp assembled on 2009-09-28

GenBank Submission: BT099852.1

> MIP14068.complete
AGTAGCACAATGGCAGGGTCCATCCGTTTCAGAATGGGTCCAATTACACT
ATTGCTTTCGATACTCTTGGTTCATAGTTGTCGAGCCGAAAAGCCGTACA
GTGTGGAGCTAAACACCTTTACGATGGACGACACCATCGAAAATCAGGAA
AATTGGGTAGACTGGGGAACGCTGAGTATGAAAAAGGTCTCACGAAATCA
ATTTGTGGTTAGCGGAGACTTTGAATTCAAACTCAATATGGCCGATGAGC
AGAAGATTGTTCTCATGGTTTATGTCTACGATTCCAATGCCAATCAAAGG
GGTTCGATGGTAATGGCTGTTAAAAAGCCGTTCTGTCAGTTCATTAAAGA
GGATGAGGACTCGTATCCAAGCATACAAAAGGCTTCCAATTTACCGGATC
AGGATACGTGCCCATTTCCGAAAGGCAAATATACTATCGATAACTACGAA
TTGGAGACCAATTTCCTACCGGACAATGCACCCAAAGGCGACTATCTGTT
GCAGTTATCCTTGTTGGATCGTGAGGTCCCAGTAGCAGGACTTGTGGCTA
CTGTTACCCTGACTTAAGGGTATATAAACATTTTTTTTCTTAATTTTTTT
TTTTATATAGTGATTTTTGATATGTTCCGGGTGGATCCATATGACACGAC
AAGCGTTCTTCTTCTTCATATTTAAGTTTACTTTTACCTTGAATATCAAT
ATAATGACTTCACTTTCAAAGTAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14068.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a.a 743 CheA7a.a 23..743 1..721 3590 99.8 Plus
CheA7a-RA 743 CheA7a-RA 23..743 1..721 3590 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7270417..7270884 254..721 2325 99.8 Plus
chrX 22417052 chrX 7270071..7270325 1..255 1275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7378486..7378960 254..728 2330 99.4 Plus
X 23542271 X 7378140..7378394 1..255 1275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7386584..7387058 254..728 2330 99.3 Plus
X 23527363 X 7386238..7386492 1..255 1275 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:35:46 has no hits.

MIP14068.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:36:43 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7270071..7270325 1..255 100 -> Plus
chrX 7270419..7270884 256..722 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:36 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..534 34..567 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:00 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..534 34..567 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:39 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..534 34..567 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:34:15 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..534 34..567 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:07 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..534 34..567 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:00 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..721 1..721 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:39 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..721 1..721 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:34:15 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
CheA7a-RA 1..721 1..721 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:43 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
X 7378140..7378394 1..255 100 -> Plus
X 7378488..7378953 256..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:43 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
X 7378140..7378394 1..255 100 -> Plus
X 7378488..7378953 256..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:43 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
X 7378140..7378394 1..255 100 -> Plus
X 7378488..7378953 256..722 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:39 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7272173..7272427 1..255 100 -> Plus
arm_X 7272521..7272986 256..722 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:06 Download gff for MIP14068.complete
Subject Subject Range Query Range Percent Splice Strand
X 7386238..7386492 1..255 100 -> Plus
X 7386586..7387051 256..722 99   Plus

MIP14068.hyp Sequence

Translation from 0 to 566

> MIP14068.hyp
SSTMAGSIRFRMGPITLLLSILLVHSCRAEKPYSVELNTFTMDDTIENQE
NWVDWGTLSMKKVSRNQFVVSGDFEFKLNMADEQKIVLMVYVYDSNANQR
GSMVMAVKKPFCQFIKEDEDSYPSIQKASNLPDQDTCPFPKGKYTIDNYE
LETNFLPDNAPKGDYLLQLSLLDREVPVAGLVATVTLT*

MIP14068.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a-PA 177 CG15033-PA 1..177 12..188 925 100 Plus

MIP14068.pep Sequence

Translation from 0 to 566

> MIP14068.pep
SSTMAGSIRFRMGPITLLLSILLVHSCRAEKPYSVELNTFTMDDTIENQE
NWVDWGTLSMKKVSRNQFVVSGDFEFKLNMADEQKIVLMVYVYDSNANQR
GSMVMAVKKPFCQFIKEDEDSYPSIQKASNLPDQDTCPFPKGKYTIDNYE
LETNFLPDNAPKGDYLLQLSLLDREVPVAGLVATVTLT*

MIP14068.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21143-PA 181 GF21143-PA 5..181 9..188 684 70 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19645-PA 190 GG19645-PA 1..190 4..188 894 88 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11885-PA 180 GH11885-PA 13..180 21..188 555 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CheA7a-PA 177 CG15033-PA 1..177 12..188 925 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15675-PA 180 GI15675-PA 22..180 30..188 595 66 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19672-PA 85 GL19672-PA 7..82 12..90 247 58.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13449-PA 180 GA13449-PA 7..180 12..188 663 67.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17522-PA 185 GM17522-PA 1..185 4..188 971 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16843-PA 185 GD16843-PA 1..185 4..188 975 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19207-PA 169 GJ19207-PA 18..168 27..188 354 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16147-PA 183 GK16147-PA 9..183 15..188 618 64 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15718-PA 178 GE15718-PA 1..178 12..188 882 92.7 Plus