MIP14123.complete Sequence
444 bp assembled on 2009-09-28
GenBank Submission: BT099855.1
> MIP14123.complete
CAAACACTCTGCCTGTGGAAAACATCGGAAACCCGTTTATTCCCATAGAG
TATCAAAACTGACCACGTCTGCACATTCCACTATGAGCAAAGTAACCTTC
AAAATCACGCTAACTTCGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGT
TCCGGAGGGAACTCCCTTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGT
TCAAGGTTCCGGCGGAGACGAGTGCCATCATCACGGACGATGGAATTGGC
ATCAGCCCACAGCAGACTGCTGGTAATGTGTTCCTAAAGCACGGATCCGA
GCTGCGCCTCATACCCAGAGATCGAGTGGGCCACCAACTAAGCTAGTTTT
CCTAATCCCATCTTATTTACCCTTTGAGATTTTCCCCCTTTTTGATGCTT
ATTAAATGTTAAACAATGTATCCGATAAAAAAAAAAAAAAAAAA
MIP14123.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:49:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191.a | 609 | CG34191.a | 161..588 | 1..428 | 2140 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:59:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 12839350..12839775 | 1..426 | 2115 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:59:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16952156..16952583 | 1..428 | 2140 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 16953355..16953782 | 1..428 | 2140 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 01:59:24 has no hits.
MIP14123.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:00:15 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 12839350..12839775 | 1..426 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:34 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 83..346 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:06 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 83..346 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:03 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 1..264 | 83..346 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:53:55 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 1..264 | 83..346 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:04 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 83..346 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:06 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 54..479 | 1..426 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:03 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 54..479 | 1..426 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:53:55 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 54..479 | 1..426 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16952156..16952581 | 1..426 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16952156..16952581 | 1..426 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16952156..16952581 | 1..426 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:03 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12839661..12840086 | 1..426 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:10 Download gff for
MIP14123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16953355..16953780 | 1..426 | 100 | | Plus |
MIP14123.hyp Sequence
Translation from 0 to 345
> MIP14123.hyp
KHSACGKHRKPVYSHRVSKLTTSAHSTMSKVTFKITLTSDPKLPFKVLSV
PEGTPFTAVLKFASEEFKVPAETSAIITDDGIGISPQQTAGNVFLKHGSE
LRLIPRDRVGHQLS*
MIP14123.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-PA | 87 | CG34191-PA | 1..87 | 28..114 | 438 | 100 | Plus |
CG34191-PB | 87 | CG34191-PB | 1..87 | 28..114 | 438 | 100 | Plus |
MIP14123.pep Sequence
Translation from 1 to 345
> MIP14123.pep
KHSACGKHRKPVYSHRVSKLTTSAHSTMSKVTFKITLTSDPKLPFKVLSV
PEGTPFTAVLKFASEEFKVPAETSAIITDDGIGISPQQTAGNVFLKHGSE
LRLIPRDRVGHQLS*
MIP14123.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH22653-PA | 84 | GH22653-PA | 1..84 | 28..111 | 421 | 97.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ufm1-PA | 87 | CG34191-PA | 1..87 | 28..114 | 438 | 100 | Plus |
Ufm1-PB | 87 | CG34191-PB | 1..87 | 28..114 | 438 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21165-PA | 84 | GI21165-PA | 1..84 | 28..111 | 428 | 98.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11573-PA | 84 | GL11573-PA | 1..84 | 28..111 | 432 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24773-PA | 84 | GA24773-PA | 1..84 | 28..111 | 432 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21018-PA | 84 | GJ21018-PA | 1..84 | 28..111 | 428 | 98.8 | Plus |