Clone MIP14123 Report

Search the DGRC for MIP14123

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:141
Well:23
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34191-RA
Protein status:MIP14123.pep: gold
Sequenced Size:444

Clone Sequence Records

MIP14123.complete Sequence

444 bp assembled on 2009-09-28

GenBank Submission: BT099855.1

> MIP14123.complete
CAAACACTCTGCCTGTGGAAAACATCGGAAACCCGTTTATTCCCATAGAG
TATCAAAACTGACCACGTCTGCACATTCCACTATGAGCAAAGTAACCTTC
AAAATCACGCTAACTTCGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGT
TCCGGAGGGAACTCCCTTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGT
TCAAGGTTCCGGCGGAGACGAGTGCCATCATCACGGACGATGGAATTGGC
ATCAGCCCACAGCAGACTGCTGGTAATGTGTTCCTAAAGCACGGATCCGA
GCTGCGCCTCATACCCAGAGATCGAGTGGGCCACCAACTAAGCTAGTTTT
CCTAATCCCATCTTATTTACCCTTTGAGATTTTCCCCCTTTTTGATGCTT
ATTAAATGTTAAACAATGTATCCGATAAAAAAAAAAAAAAAAAA

MIP14123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191.a 609 CG34191.a 161..588 1..428 2140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12839350..12839775 1..426 2115 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16952156..16952583 1..428 2140 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16953355..16953782 1..428 2140 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:59:24 has no hits.

MIP14123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:00:15 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12839350..12839775 1..426 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:34 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 83..346 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:06 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 83..346 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:03 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 1..264 83..346 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:53:55 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 1..264 83..346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:04 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 83..346 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:06 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 54..479 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:03 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 54..479 1..426 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:53:55 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 54..479 1..426 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16952156..16952581 1..426 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16952156..16952581 1..426 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:15 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16952156..16952581 1..426 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:03 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12839661..12840086 1..426 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:10 Download gff for MIP14123.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16953355..16953780 1..426 100   Plus

MIP14123.hyp Sequence

Translation from 0 to 345

> MIP14123.hyp
KHSACGKHRKPVYSHRVSKLTTSAHSTMSKVTFKITLTSDPKLPFKVLSV
PEGTPFTAVLKFASEEFKVPAETSAIITDDGIGISPQQTAGNVFLKHGSE
LRLIPRDRVGHQLS*

MIP14123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-PA 87 CG34191-PA 1..87 28..114 438 100 Plus
CG34191-PB 87 CG34191-PB 1..87 28..114 438 100 Plus

MIP14123.pep Sequence

Translation from 1 to 345

> MIP14123.pep
KHSACGKHRKPVYSHRVSKLTTSAHSTMSKVTFKITLTSDPKLPFKVLSV
PEGTPFTAVLKFASEEFKVPAETSAIITDDGIGISPQQTAGNVFLKHGSE
LRLIPRDRVGHQLS*

MIP14123.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22653-PA 84 GH22653-PA 1..84 28..111 421 97.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ufm1-PA 87 CG34191-PA 1..87 28..114 438 100 Plus
Ufm1-PB 87 CG34191-PB 1..87 28..114 438 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21165-PA 84 GI21165-PA 1..84 28..111 428 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11573-PA 84 GL11573-PA 1..84 28..111 432 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24773-PA 84 GA24773-PA 1..84 28..111 432 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21018-PA 84 GJ21018-PA 1..84 28..111 428 98.8 Plus