Clone MIP14126 Report

Search the DGRC for MIP14126

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:141
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptwhip-RA
Protein status:MIP14126.pep: gold
Sequenced Size:870

Clone Sequence Records

MIP14126.complete Sequence

870 bp assembled on 2009-10-12

GenBank Submission: BT100030.1

> MIP14126.complete
TATAAAATGAATCGATTATTTCGGAGTCACCCATTTTTTAATCAAGCAAC
AGGCTTCCAAATCGAACGTTTCCATTTAGATACTACCCAACCCATCTCTC
ACGCAGACCGAAGCATTCAGGGAAACTAAGCAGCAGAAGAAGCCAGCGAG
AACTGGTGAGGATCTGAGATGGGTACCTCTGTATTGGCCACGATGTGTGC
TGAGCGCCTGACCAAGCTCCTCGTCCGCTACTCCCGTGCTCAGCCTCCCG
TGGGGCGGAATCAGTCCCACTGCGTCGATAATGTGCTAAGTCCTTTGCCA
AGGAGCGAAGCAACTACCGCCTTCCTGAAGCCAATGAACAATGCTGGCCA
GGACCATCCCCCATCGAAGTCGGCCAACAAGTGGCAGCCGATGGGTACCA
TCACGAGCATCGGACAGAGATTCCAGCGTGAGGCCATGGATGAGATTTGT
GCCAGGGCCAAGGACCGCCTGCTGCCAAAGACCGAACCTCGACGCTTGAA
CTTCTCTAGAAATCACGCTTTCTTCCCCAACAAATCGAGAGGCCTTGAAG
ATTGGAAGAAACCGGAGGGTGGGCGGTACTCAGCTCCATTTGTCAGCCTA
TTCCAGGCTCCGAACTGTCCTAGTCTGCCTAAGAAGTCGTTTTCTCATCC
GCTTGCCTTCGATCGTCAAAAACTGTATCGAGACTGCTATTAACCAGAAA
AAAATGAAAGTTTTCGATCCTGATGCCAAACTCATACGCAGACCAATTAC
TCCACGCTCATTTTAGCGTAGTGATTGGGTTGCACTTGCGATTGGCATCA
GGGGTCCAAGATTCTCCACAATTAGCCGTATTAAAGATGTAATGTGTAAA
AAAAAAAAAAAAAAAAAAAA

MIP14126.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
whip-RA 869 whip-RA 14..863 1..850 4250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4249882..4250728 847..1 4205 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8362356..8363205 850..1 4250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8363555..8364404 850..1 4250 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:00:50 has no hits.

MIP14126.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:01:47 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4249882..4250728 1..847 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:38 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
CG34218-RA 1..501 193..693 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:43:30 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 1..501 193..693 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:34:04 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 1..501 193..693 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:12 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 1..501 193..693 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-12 14:24:08 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
CG34218-RA 14..860 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:43:30 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 14..860 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:34:04 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 14..860 1..847 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:12 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
whip-RA 14..860 1..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:47 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8362359..8363205 1..847 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:47 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8362359..8363205 1..847 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:47 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8362359..8363205 1..847 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:34:04 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4249864..4250710 1..847 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:24:23 Download gff for MIP14126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8363558..8364404 1..847 100   Minus

MIP14126.hyp Sequence

Translation from 168 to 692

> MIP14126.hyp
MGTSVLATMCAERLTKLLVRYSRAQPPVGRNQSHCVDNVLSPLPRSEATT
AFLKPMNNAGQDHPPSKSANKWQPMGTITSIGQRFQREAMDEICARAKDR
LLPKTEPRRLNFSRNHAFFPNKSRGLEDWKKPEGGRYSAPFVSLFQAPNC
PSLPKKSFSHPLAFDRQKLYRDCY*

MIP14126.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
whip-PA 166 CG34218-PA 1..166 9..174 899 100 Plus

MIP14126.pep Sequence

Translation from 168 to 692

> MIP14126.pep
MGTSVLATMCAERLTKLLVRYSRAQPPVGRNQSHCVDNVLSPLPRSEATT
AFLKPMNNAGQDHPPSKSANKWQPMGTITSIGQRFQREAMDEICARAKDR
LLPKTEPRRLNFSRNHAFFPNKSRGLEDWKKPEGGRYSAPFVSLFQAPNC
PSLPKKSFSHPLAFDRQKLYRDCY*

MIP14126.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12595-PA 182 GF12595-PA 1..182 1..174 315 42.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10653-PA 166 GG10653-PA 1..166 9..174 806 90.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
whip-PA 166 CG34218-PA 1..166 9..174 899 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20698-PA 174 GM20698-PA 1..174 1..174 875 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15281-PA 174 GD15281-PA 1..174 1..174 862 93.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23124-PA 174 GE23124-PA 1..174 1..174 843 89.1 Plus