MIP14151.complete Sequence
421 bp assembled on 2009-09-28
GenBank Submission: BT099878.1
> MIP14151.complete
TAGATATTAACTTGTTTTTCGCTGTTGATTTTCAGTCTTTTCGAGGCATT
CGAAAGGCACAAGTACTCCTGCTGAATAAGACAAATTAAAAATGAAGCTT
TTTTCCATTGTTTTCTTCATTTTTTCCATACTTGGCTGTGTTTCAGCTTT
GAAAAACCCTGTCTGCGGAGTTAAATATCGAGGAGTTGGCCTATGTAAAA
TGTTAATCACGAAAATAGTTTATATACCCACTGAAAACAAATGCAAAACG
GTGCACATTAGTGGATGTTCGGCCGAAGGAACTTTCTTCAAAAGCATCAA
GGAGTGTGAAGCTAAATGCAAGGAATATTAAATTAAGATTTTAGGAATTT
AAAAAAGTGTTTCAAAATATAAATAGCCGCGATTACTATAGTAATATTAA
TACCAAAAAAAAAAAAAAAAA
MIP14151.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:50:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42460-RA | 546 | CG42460-RA | 17..421 | 1..405 | 2025 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3387664..3387909 | 404..159 | 1170 | 98.4 | Minus |
chr2L | 23010047 | chr2L | 3387968..3388126 | 158..1 | 700 | 97.5 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3388023..3388269 | 405..159 | 1235 | 100 | Minus |
2L | 23513712 | 2L | 3388332..3388489 | 158..1 | 790 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3388023..3388269 | 405..159 | 1235 | 100 | Minus |
2L | 23513712 | 2L | 3388332..3388489 | 158..1 | 790 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 12:10:42 has no hits.
MIP14151.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3387664..3387909 | 159..404 | 98 | <- | Minus |
chr2L | 3387968..3388126 | 1..158 | 97 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:50 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 1..240 | 92..331 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:51 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 1..240 | 92..331 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:19:02 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 1..240 | 92..331 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 1..240 | 92..331 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 13:21:21 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 8..411 | 1..404 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:51 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 8..411 | 1..404 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:19:02 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 8..411 | 1..404 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42460-RA | 8..411 | 1..404 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3388024..3388269 | 159..404 | 100 | <- | Minus |
2L | 3388332..3388489 | 1..158 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3388024..3388269 | 159..404 | 100 | <- | Minus |
2L | 3388332..3388489 | 1..158 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3388024..3388269 | 159..404 | 100 | <- | Minus |
2L | 3388332..3388489 | 1..158 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:19:02 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3388332..3388489 | 1..158 | 100 | | Minus |
arm_2L | 3388024..3388269 | 159..404 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:37 Download gff for
MIP14151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3388024..3388269 | 159..404 | 100 | <- | Minus |
2L | 3388332..3388489 | 1..158 | 100 | | Minus |
MIP14151.hyp Sequence
Translation from 91 to 330
> MIP14151.hyp
MKLFSIVFFIFSILGCVSALKNPVCGVKYRGVGLCKMLITKIVYIPTENK
CKTVHISGCSAEGTFFKSIKECEAKCKEY*
MIP14151.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42460-PB | 79 | CG42460-PB | 1..79 | 1..79 | 421 | 100 | Plus |
CG42460-PA | 79 | CG42460-PA | 1..79 | 1..79 | 421 | 100 | Plus |
Sfp23F-PA | 78 | CG42459-PA | 1..78 | 1..78 | 212 | 52.6 | Plus |
Sfp24Bc-PA | 100 | CG42602-PA | 1..76 | 1..76 | 143 | 34.2 | Plus |
CG16704-PB | 79 | CG16704-PB | 6..78 | 10..77 | 134 | 37 | Plus |
MIP14151.pep Sequence
Translation from 91 to 330
> MIP14151.pep
MKLFSIVFFIFSILGCVSALKNPVCGVKYRGVGLCKMLITKIVYIPTENK
CKTVHISGCSAEGTFFKSIKECEAKCKEY*
MIP14151.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:53:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14654-PA | 82 | GF14654-PA | 1..82 | 1..78 | 135 | 37.8 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:53:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH13180-PA | 81 | GH13180-PA | 1..80 | 1..76 | 136 | 37.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42460-PB | 79 | CG42460-PB | 1..79 | 1..79 | 421 | 100 | Plus |
CG42460-PA | 79 | CG42460-PA | 1..79 | 1..79 | 421 | 100 | Plus |
Sfp23F-PA | 78 | CG42459-PA | 1..78 | 1..78 | 212 | 52.6 | Plus |
Sfp24Bc-PA | 100 | CG42602-PA | 1..76 | 1..76 | 143 | 34.2 | Plus |
CG16704-PB | 79 | CG16704-PB | 6..78 | 10..77 | 134 | 37 | Plus |
CG16704-PA | 79 | CG16704-PA | 6..78 | 10..77 | 134 | 37 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:53:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI23877-PA | 82 | GI23877-PA | 1..82 | 1..78 | 127 | 32.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:53:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL19427-PA | 78 | GL19427-PA | 1..78 | 1..78 | 136 | 37.2 | Plus |
Dper\GL19459-PA | 82 | GL19459-PA | 1..82 | 1..78 | 133 | 37.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:53:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25956-PA | 78 | GA25956-PA | 1..78 | 1..78 | 145 | 38.5 | Plus |
Dpse\GA14098-PA | 82 | GA14098-PA | 1..82 | 1..78 | 135 | 39 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:53:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18131-PA | 78 | GM18131-PA | 1..77 | 1..77 | 131 | 35.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:53:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15472-PA | 79 | GK15472-PA | 1..78 | 1..77 | 138 | 34.6 | Plus |
Dwil\GK18965-PA | 79 | GK18965-PA | 1..78 | 1..77 | 132 | 33.3 | Plus |