Clone MIP14151 Report

Search the DGRC for MIP14151

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:141
Well:51
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42460-RA
Protein status:MIP14151.pep: gold
Sequenced Size:421

Clone Sequence Records

MIP14151.complete Sequence

421 bp assembled on 2009-09-28

GenBank Submission: BT099878.1

> MIP14151.complete
TAGATATTAACTTGTTTTTCGCTGTTGATTTTCAGTCTTTTCGAGGCATT
CGAAAGGCACAAGTACTCCTGCTGAATAAGACAAATTAAAAATGAAGCTT
TTTTCCATTGTTTTCTTCATTTTTTCCATACTTGGCTGTGTTTCAGCTTT
GAAAAACCCTGTCTGCGGAGTTAAATATCGAGGAGTTGGCCTATGTAAAA
TGTTAATCACGAAAATAGTTTATATACCCACTGAAAACAAATGCAAAACG
GTGCACATTAGTGGATGTTCGGCCGAAGGAACTTTCTTCAAAAGCATCAA
GGAGTGTGAAGCTAAATGCAAGGAATATTAAATTAAGATTTTAGGAATTT
AAAAAAGTGTTTCAAAATATAAATAGCCGCGATTACTATAGTAATATTAA
TACCAAAAAAAAAAAAAAAAA

MIP14151.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42460-RA 546 CG42460-RA 17..421 1..405 2025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3387664..3387909 404..159 1170 98.4 Minus
chr2L 23010047 chr2L 3387968..3388126 158..1 700 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3388023..3388269 405..159 1235 100 Minus
2L 23513712 2L 3388332..3388489 158..1 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3388023..3388269 405..159 1235 100 Minus
2L 23513712 2L 3388332..3388489 158..1 790 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:10:42 has no hits.

MIP14151.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3387664..3387909 159..404 98 <- Minus
chr2L 3387968..3388126 1..158 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:50 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 1..240 92..331 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:51 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 1..240 92..331 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:19:02 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 1..240 92..331 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 1..240 92..331 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 13:21:21 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 8..411 1..404 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:51 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 8..411 1..404 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:19:02 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 8..411 1..404 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
CG42460-RA 8..411 1..404 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3388024..3388269 159..404 100 <- Minus
2L 3388332..3388489 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3388024..3388269 159..404 100 <- Minus
2L 3388332..3388489 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:42 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3388024..3388269 159..404 100 <- Minus
2L 3388332..3388489 1..158 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:19:02 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3388332..3388489 1..158 100   Minus
arm_2L 3388024..3388269 159..404 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:37 Download gff for MIP14151.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3388024..3388269 159..404 100 <- Minus
2L 3388332..3388489 1..158 100   Minus

MIP14151.hyp Sequence

Translation from 91 to 330

> MIP14151.hyp
MKLFSIVFFIFSILGCVSALKNPVCGVKYRGVGLCKMLITKIVYIPTENK
CKTVHISGCSAEGTFFKSIKECEAKCKEY*

MIP14151.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42460-PB 79 CG42460-PB 1..79 1..79 421 100 Plus
CG42460-PA 79 CG42460-PA 1..79 1..79 421 100 Plus
Sfp23F-PA 78 CG42459-PA 1..78 1..78 212 52.6 Plus
Sfp24Bc-PA 100 CG42602-PA 1..76 1..76 143 34.2 Plus
CG16704-PB 79 CG16704-PB 6..78 10..77 134 37 Plus

MIP14151.pep Sequence

Translation from 91 to 330

> MIP14151.pep
MKLFSIVFFIFSILGCVSALKNPVCGVKYRGVGLCKMLITKIVYIPTENK
CKTVHISGCSAEGTFFKSIKECEAKCKEY*

MIP14151.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14654-PA 82 GF14654-PA 1..82 1..78 135 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13180-PA 81 GH13180-PA 1..80 1..76 136 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42460-PB 79 CG42460-PB 1..79 1..79 421 100 Plus
CG42460-PA 79 CG42460-PA 1..79 1..79 421 100 Plus
Sfp23F-PA 78 CG42459-PA 1..78 1..78 212 52.6 Plus
Sfp24Bc-PA 100 CG42602-PA 1..76 1..76 143 34.2 Plus
CG16704-PB 79 CG16704-PB 6..78 10..77 134 37 Plus
CG16704-PA 79 CG16704-PA 6..78 10..77 134 37 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23877-PA 82 GI23877-PA 1..82 1..78 127 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19427-PA 78 GL19427-PA 1..78 1..78 136 37.2 Plus
Dper\GL19459-PA 82 GL19459-PA 1..82 1..78 133 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25956-PA 78 GA25956-PA 1..78 1..78 145 38.5 Plus
Dpse\GA14098-PA 82 GA14098-PA 1..82 1..78 135 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18131-PA 78 GM18131-PA 1..77 1..77 131 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15472-PA 79 GK15472-PA 1..78 1..77 138 34.6 Plus
Dwil\GK18965-PA 79 GK18965-PA 1..78 1..77 132 33.3 Plus