Clone MIP14174 Report

Search the DGRC for MIP14174

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:141
Well:74
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptEig71Eb-RA
Protein status:MIP14174.pep: gold
Sequenced Size:409

Clone Sequence Records

MIP14174.complete Sequence

409 bp assembled on 2009-09-28

GenBank Submission: BT099844.1

> MIP14174.complete
TACGGAATTCACGATGTCCAAGATTACTCTGTTTATTGCTTTTATTTGCC
TTTTCGTTATCGTTCAGGCCCAAAGTGATAGAGATATTTGTAGACGGATT
GTCGCCAGATGTGAGTCAAGGGTCGTGAGAAATGGCAGAAACAACGATAT
TTCGAATATTTTCAATGAGAACTGTCGGCGAACACAAAGAAATTGGCGTG
AAATCTCCCGATGCGAACTCGCAAAAGCTAATTGTATATTGACCCTTGAG
CGATGTAACACGTTGTCCTGCGAGAATGTCCGGCGAGCCCTTGCACAATA
AAATACCAAGATCAGATTCGAAACATTTAATCGACATCTATAAAAAATCC
GTCTTTACTGCAATTAAATAAATACTTCGATGCTCTCAATAAAAAAAAAA
AAAAAAAAA

MIP14174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-RA 558 Eig71Eb-RA 93..483 1..391 1955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15639984..15640185 38..239 1010 100 Plus
chr3L 24539361 chr3L 15640246..15640396 240..390 755 100 Plus
chr3L 24539361 chr3L 15639873..15639910 1..38 190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15650082..15650283 38..239 1010 100 Plus
3L 28110227 3L 15650344..15650495 240..391 760 100 Plus
3L 28110227 3L 15649971..15650008 1..38 190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15643182..15643383 38..239 1010 100 Plus
3L 28103327 3L 15643444..15643595 240..391 760 100 Plus
3L 28103327 3L 15643071..15643108 1..38 190 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:00:37 has no hits.

MIP14174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:01:26 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15640246..15640396 240..390 100   Plus
chr3L 15639873..15639910 1..38 100 -> Plus
chr3L 15639985..15640185 39..239 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:40 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 1..288 14..301 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:33:42 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RB 1..288 14..301 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:05 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 1..288 14..301 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:52:38 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 1..288 14..301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:16 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 11..400 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:33:42 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 36..425 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:05 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 36..425 1..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:52:38 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 36..425 1..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:01:26 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15650344..15650494 240..390 100   Plus
3L 15649971..15650008 1..38 100 -> Plus
3L 15650083..15650283 39..239 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:01:26 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15650344..15650494 240..390 100   Plus
3L 15649971..15650008 1..38 100 -> Plus
3L 15650083..15650283 39..239 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:01:26 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15650344..15650494 240..390 100   Plus
3L 15649971..15650008 1..38 100 -> Plus
3L 15650083..15650283 39..239 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:05 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15643183..15643383 39..239 100 -> Plus
arm_3L 15643444..15643594 240..390 100   Plus
arm_3L 15643071..15643108 1..38 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:54 Download gff for MIP14174.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15643071..15643108 1..38 100 -> Plus
3L 15643183..15643383 39..239 100 -> Plus
3L 15643444..15643594 240..390 100   Plus

MIP14174.hyp Sequence

Translation from 0 to 300

> MIP14174.hyp
TEFTMSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDI
SNIFNENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQ*

MIP14174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-PB 95 CG7355-PB 1..95 5..99 495 100 Plus
Eig71Eb-PA 95 CG7355-PA 1..95 5..99 495 100 Plus
Eig71Ec-PA 173 CG7608-PA 1..96 5..97 241 51 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 5..97 214 42.7 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 5..93 171 35.8 Plus

MIP14174.pep Sequence

Translation from 1 to 300

> MIP14174.pep
TEFTMSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDI
SNIFNENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQ*

MIP14174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24086-PA 100 GF24086-PA 1..94 5..97 271 59.6 Plus
Dana\GF10383-PA 183 GF10383-PA 24..94 8..78 197 50.7 Plus
Dana\GF24089-PA 122 GF24089-PA 42..120 19..97 160 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15917-PA 94 GG15917-PA 1..94 5..98 380 76.6 Plus
Dere\GG15920-PA 98 GG15920-PA 1..96 5..97 200 43.8 Plus
Dere\GG13529-PA 270 GG13529-PA 1..77 5..78 188 54.5 Plus
Dere\GG15921-PA 102 GG15921-PA 1..95 5..93 155 35.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23314-PA 96 GH23314-PA 18..96 21..96 147 41.8 Plus
Dgri\GH14477-PA 96 GH14477-PA 18..96 21..96 147 41.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-PB 95 CG7355-PB 1..95 5..99 495 100 Plus
Eig71Eb-PA 95 CG7355-PA 1..95 5..99 495 100 Plus
Eig71Ec-PA 173 CG7608-PA 1..96 5..97 241 51 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 5..97 214 42.7 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 5..93 171 35.8 Plus
Eig71Ei-PA 102 CG7327-PA 1..95 5..93 171 35.8 Plus
Eig71Ek-PA 97 CG7325-PA 1..95 5..97 160 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13624-PA 97 GI13624-PA 1..96 5..97 203 45.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15724-PA 132 GL15724-PA 4..94 11..97 195 48.4 Plus
Dper\GL25493-PA 192 GL25493-PA 1..78 5..78 182 47.4 Plus
Dper\GL24996-PA 98 GL24996-PA 20..89 21..91 146 42.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20289-PA 216 GA20289-PA 1..101 5..97 238 50.5 Plus
Dpse\GA23777-PA 138 GA23777-PA 1..97 5..97 216 50.5 Plus
Dpse\GA20272-PA 95 GA20272-PA 20..95 21..97 158 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25549-PA 94 GM25549-PA 1..94 5..98 435 93.6 Plus
Dsec\GM24473-PA 162 GM24473-PA 1..96 5..97 210 51 Plus
Dsec\GM25551-PA 100 GM25551-PA 1..98 5..97 179 41.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14562-PA 94 GD14562-PA 1..94 5..98 439 94.7 Plus
Dsim\GD12547-PA 162 GD12547-PA 1..96 5..97 214 52.1 Plus
Dsim\GD14564-PA 98 GD14564-PA 1..96 5..97 207 44.8 Plus
Dsim\GD14565-PA 102 GD14565-PA 1..95 5..93 161 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13962-PA 94 GJ13962-PA 1..92 5..97 189 43 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15233-PA 98 GK15233-PA 1..96 5..97 206 45.8 Plus
Dwil\GK20719-PA 124 GK20719-PA 1..95 5..97 178 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22264-PA 95 GE22264-PA 1..95 5..99 432 90.5 Plus
Dyak\GE23154-PA 95 GE23154-PA 1..95 5..99 427 88.4 Plus
Dyak\GE19824-PA 186 GE19824-PA 1..93 5..97 225 53.7 Plus
Dyak\GE22832-PA 193 GE22832-PA 1..93 5..97 224 54.7 Plus
Dyak\GE22266-PA 98 GE22266-PA 1..96 5..97 204 43.8 Plus