Clone MIP14235 Report

Search the DGRC for MIP14235

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:142
Well:35
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34284-RA
Protein status:MIP14235.pep: gold
Sequenced Size:445

Clone Sequence Records

MIP14235.complete Sequence

445 bp assembled on 2011-03-10

GenBank Submission: BT126156.1

> MIP14235.complete
AGTCGGTCATTGAAAGTTTCCAGAAAATGTCGAGTGCAGTGCTGATAGCT
TTCTGCGTCTTGGTTGTTTTGACCGGACAATCGGTTGGCCAAAATGTGGC
CGTGCAACAGTCAATTGATTGGGCCAATGAACAGTTCAAAATCGCTCAAG
TTGTGGCCCAAGGAAAGCTACCCAACAGTGTTGAGGCCCGGAACGATGCC
AATGACCAATTGGACACTCTGAAATTGGCTTTATCCCATTGCGAGGCTGA
GCTGAAATCCACCCAAGGTGTCGATCTTCACAAGACTTGTGTTAAAGCCG
TCTTCGCTGGCTTTTATACTGCCTTGGATCGCTTGGCCGCGGAACACTGG
CCCATTTATGGAGCCACCTCTGGTGCCGCCCGAATTGGCTTCTTCTGCTA
ATTAACGTAATCATCTTACAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14235.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14726426..14726774 419..71 1745 100 Minus
chr3R 27901430 chr3R 14726850..14726920 71..1 355 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18902436..18902787 422..71 1760 100 Minus
3R 32079331 3R 18902863..18902933 71..1 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18643267..18643618 422..71 1760 100 Minus
3R 31820162 3R 18643694..18643764 71..1 355 100 Minus
Blast to na_te.dros performed 2019-03-16 22:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 3240..3304 38..102 108 66.7 Plus

MIP14235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:24 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14726426..14726773 72..419 100 <- Minus
chr3R 14726850..14726920 1..71 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-10 16:42:39 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:55:02 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:22 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..375 27..401 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-10 16:42:38 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..419 1..419 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:55:02 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..419 1..419 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:22 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
CG34284-RA 1..419 1..419 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:24 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18902439..18902786 72..419 100 <- Minus
3R 18902863..18902933 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:24 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18902439..18902786 72..419 100 <- Minus
3R 18902863..18902933 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:24 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18902439..18902786 72..419 100 <- Minus
3R 18902863..18902933 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:55:02 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14728161..14728508 72..419 100 <- Minus
arm_3R 14728585..14728655 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:07 Download gff for MIP14235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18643270..18643617 72..419 100 <- Minus
3R 18643694..18643764 1..71 100   Minus

MIP14235.hyp Sequence

Translation from 2 to 400

> MIP14235.hyp
SVIESFQKMSSAVLIAFCVLVVLTGQSVGQNVAVQQSIDWANEQFKIAQV
VAQGKLPNSVEARNDANDQLDTLKLALSHCEAELKSTQGVDLHKTCVKAV
FAGFYTALDRLAAEHWPIYGATSGAARIGFFC*

MIP14235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34284-PA 124 CG34284-PA 1..124 9..132 634 100 Plus

MIP14235.pep Sequence

Translation from 2 to 400

> MIP14235.pep
SVIESFQKMSSAVLIAFCVLVVLTGQSVGQNVAVQQSIDWANEQFKIAQV
VAQGKLPNSVEARNDANDQLDTLKLALSHCEAELKSTQGVDLHKTCVKAV
FAGFYTALDRLAAEHWPIYGATSGAARIGFFC*

MIP14235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23014-PA 124 GF23014-PA 1..123 9..131 271 42.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16300-PA 124 GG16300-PA 1..124 9..132 582 87.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34284-PA 124 CG34284-PA 1..124 9..132 634 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24112-PA 124 GL24112-PA 1..123 9..131 304 45.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26508-PA 124 GA26508-PA 1..123 9..131 305 46.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18676-PA 124 GM18676-PA 1..124 9..132 626 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20147-PA 124 GD20147-PA 1..124 9..132 625 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25165-PA 124 GE25165-PA 1..124 9..132 613 93.5 Plus