BDGP Sequence Production Resources |
Search the DGRC for MIP14249
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 142 |
Well: | 49 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG42288-RA |
Protein status: | MIP14249.pep: gold |
Sequenced Size: | 672 |
672 bp assembled on 2009-09-28
GenBank Submission: BT099861.1
> MIP14249.complete ATTTTCAACAAATTTCAGTTTCTCAGGAAAGCTTTGAAAATTGTTGTTTA AAACTTGCAGTGCGGCTGAGGATCGGATCAATCATGGCCTGTCGCTGCAA ATATCTGAAGCAGATCTTTACCAAGTGCTGCTACTGCTATTCCCTGCGTT TCGGTGTGCTGCTCTTCGGATGCATTTTTCTAACCTGGTTCATTTACATC ACCATCGGCACCGGCTTCATGATGGAGTGCATCTTTCCGAACGAGTATCA GAGGTCCCTTATCCCAGCACCGGCGGCCCTCAAGGCCACCATGGTCTTCT CCTTCTTCGGCATCATAGTTTCGGCCATGCTCTGCCTGGGAGTGCACAAT AACAACGAGATGCTCTTCCTGCCATTTTTGGTTTTCACACCCATTTGGAT AATTGTGCACATTTTTGCCCTGACCGTTTACAGCTTTAATACCATCATCA TCATCCTGACTGTCATCACAATGTTACTTTTAGTGTATGCCTGGCTGGTG GTTTGGTCCTACTACATAGAACTGCTCTTCGCCTACGAAGATGAACTGGA AACCGGTTATGTGTAATAATAGTAATAATAATGATATTTACAAATTTTAG TATGTTGAGCAAGCATTTGATGTGCCTAATAAAATAATGCATGTAGGATA CAGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42288-RA | 684 | CG42288-RA | 30..684 | 1..655 | 3275 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9978377..9978726 | 1..350 | 1720 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 9978987..9979165 | 475..653 | 895 | 100 | Plus |
chr2R | 21145070 | chr2R | 9978799..9978922 | 351..474 | 605 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14091026..14091375 | 1..350 | 1750 | 100 | Plus |
2R | 25286936 | 2R | 14091636..14091817 | 475..656 | 910 | 100 | Plus |
2R | 25286936 | 2R | 14091448..14091571 | 351..474 | 620 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14092225..14092574 | 1..350 | 1750 | 100 | Plus |
2R | 25260384 | 2R | 14092835..14093016 | 475..656 | 910 | 100 | Plus |
2R | 25260384 | 2R | 14092647..14092770 | 351..474 | 620 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord2 | 7650 | accord2 QBERT 7650bp | 5430..5499 | 556..623 | 128 | 68.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9978987..9979165 | 475..653 | 100 | Plus | |
chr2R | 9978377..9978726 | 1..350 | 99 | -> | Plus |
chr2R | 9978799..9978922 | 351..474 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..483 | 84..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..483 | 84..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..483 | 84..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..483 | 84..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..639 | 6..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..639 | 6..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..648 | 6..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42288-RA | 1..648 | 6..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14091636..14091814 | 475..653 | 100 | Plus | |
2R | 14091026..14091375 | 1..350 | 100 | -> | Plus |
2R | 14091448..14091571 | 351..474 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14091636..14091814 | 475..653 | 100 | Plus | |
2R | 14091026..14091375 | 1..350 | 100 | -> | Plus |
2R | 14091448..14091571 | 351..474 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14091636..14091814 | 475..653 | 100 | Plus | |
2R | 14091026..14091375 | 1..350 | 100 | -> | Plus |
2R | 14091448..14091571 | 351..474 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9978531..9978880 | 1..350 | 100 | -> | Plus |
arm_2R | 9978953..9979076 | 351..474 | 100 | -> | Plus |
arm_2R | 9979141..9979319 | 475..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14092225..14092574 | 1..350 | 100 | -> | Plus |
2R | 14092647..14092770 | 351..474 | 100 | -> | Plus |
2R | 14092835..14093013 | 475..653 | 100 | Plus |
Translation from 2 to 565
> MIP14249.hyp FQQISVSQESFENCCLKLAVRLRIGSIMACRCKYLKQIFTKCCYCYSLRF GVLLFGCIFLTWFIYITIGTGFMMECIFPNEYQRSLIPAPAALKATMVFS FFGIIVSAMLCLGVHNNNEMLFLPFLVFTPIWIIVHIFALTVYSFNTIII ILTVITMLLLVYAWLVVWSYYIELLFAYEDELETGYV*
Translation from 2 to 565
> MIP14249.pep FQQISVSQESFENCCLKLAVRLRIGSIMACRCKYLKQIFTKCCYCYSLRF GVLLFGCIFLTWFIYITIGTGFMMECIFPNEYQRSLIPAPAALKATMVFS FFGIIVSAMLCLGVHNNNEMLFLPFLVFTPIWIIVHIFALTVYSFNTIII ILTVITMLLLVYAWLVVWSYYIELLFAYEDELETGYV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20422-PA | 164 | GG20422-PA | 94..164 | 117..187 | 326 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22674-PA | 162 | GH22674-PA | 1..154 | 28..181 | 546 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42288-PA | 160 | CG42288-PA | 1..160 | 28..187 | 856 | 100 | Plus |
CG42288-PB | 157 | CG42288-PB | 1..157 | 28..187 | 830 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21185-PA | 209 | GI21185-PA | 43..209 | 21..187 | 553 | 61.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11246-PA | 286 | GL11246-PA | 127..286 | 28..187 | 574 | 66.2 | Plus |
Dper\GL11738-PA | 101 | GL11738-PA | 27..90 | 53..116 | 262 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24659-PA | 160 | GA24659-PA | 1..160 | 28..187 | 572 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21508-PA | 255 | GM21508-PA | 92..255 | 24..187 | 834 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11002-PA | 122 | GD11002-PA | 3..122 | 39..187 | 162 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21041-PA | 161 | GJ21041-PA | 1..154 | 28..181 | 503 | 61 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22082-PA | 239 | GK22082-PA | 77..233 | 25..182 | 562 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13553-PA | 255 | GE13553-PA | 85..255 | 18..187 | 785 | 88.3 | Plus |