Clone MIP14249 Report

Search the DGRC for MIP14249

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:142
Well:49
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42288-RA
Protein status:MIP14249.pep: gold
Sequenced Size:672

Clone Sequence Records

MIP14249.complete Sequence

672 bp assembled on 2009-09-28

GenBank Submission: BT099861.1

> MIP14249.complete
ATTTTCAACAAATTTCAGTTTCTCAGGAAAGCTTTGAAAATTGTTGTTTA
AAACTTGCAGTGCGGCTGAGGATCGGATCAATCATGGCCTGTCGCTGCAA
ATATCTGAAGCAGATCTTTACCAAGTGCTGCTACTGCTATTCCCTGCGTT
TCGGTGTGCTGCTCTTCGGATGCATTTTTCTAACCTGGTTCATTTACATC
ACCATCGGCACCGGCTTCATGATGGAGTGCATCTTTCCGAACGAGTATCA
GAGGTCCCTTATCCCAGCACCGGCGGCCCTCAAGGCCACCATGGTCTTCT
CCTTCTTCGGCATCATAGTTTCGGCCATGCTCTGCCTGGGAGTGCACAAT
AACAACGAGATGCTCTTCCTGCCATTTTTGGTTTTCACACCCATTTGGAT
AATTGTGCACATTTTTGCCCTGACCGTTTACAGCTTTAATACCATCATCA
TCATCCTGACTGTCATCACAATGTTACTTTTAGTGTATGCCTGGCTGGTG
GTTTGGTCCTACTACATAGAACTGCTCTTCGCCTACGAAGATGAACTGGA
AACCGGTTATGTGTAATAATAGTAATAATAATGATATTTACAAATTTTAG
TATGTTGAGCAAGCATTTGATGTGCCTAATAAAATAATGCATGTAGGATA
CAGAAAAAAAAAAAAAAAAAAA

MIP14249.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-RA 684 CG42288-RA 30..684 1..655 3275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9978377..9978726 1..350 1720 99.4 Plus
chr2R 21145070 chr2R 9978987..9979165 475..653 895 100 Plus
chr2R 21145070 chr2R 9978799..9978922 351..474 605 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14091026..14091375 1..350 1750 100 Plus
2R 25286936 2R 14091636..14091817 475..656 910 100 Plus
2R 25286936 2R 14091448..14091571 351..474 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14092225..14092574 1..350 1750 100 Plus
2R 25260384 2R 14092835..14093016 475..656 910 100 Plus
2R 25260384 2R 14092647..14092770 351..474 620 100 Plus
Blast to na_te.dros performed 2019-03-16 12:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 5430..5499 556..623 128 68.6 Plus

MIP14249.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:17:01 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9978987..9979165 475..653 100   Plus
chr2R 9978377..9978726 1..350 99 -> Plus
chr2R 9978799..9978922 351..474 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:30 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..483 84..566 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:13 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..483 84..566 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:21:28 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..483 84..566 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:40:44 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..483 84..566 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:33:57 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:13 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..639 6..644 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:21:28 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..648 6..653 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:40:44 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
CG42288-RA 1..648 6..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:01 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14091636..14091814 475..653 100   Plus
2R 14091026..14091375 1..350 100 -> Plus
2R 14091448..14091571 351..474 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:01 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14091636..14091814 475..653 100   Plus
2R 14091026..14091375 1..350 100 -> Plus
2R 14091448..14091571 351..474 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:17:01 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14091636..14091814 475..653 100   Plus
2R 14091026..14091375 1..350 100 -> Plus
2R 14091448..14091571 351..474 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:21:28 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9978531..9978880 1..350 100 -> Plus
arm_2R 9978953..9979076 351..474 100 -> Plus
arm_2R 9979141..9979319 475..653 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:15 Download gff for MIP14249.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14092225..14092574 1..350 100 -> Plus
2R 14092647..14092770 351..474 100 -> Plus
2R 14092835..14093013 475..653 100   Plus

MIP14249.hyp Sequence

Translation from 2 to 565

> MIP14249.hyp
FQQISVSQESFENCCLKLAVRLRIGSIMACRCKYLKQIFTKCCYCYSLRF
GVLLFGCIFLTWFIYITIGTGFMMECIFPNEYQRSLIPAPAALKATMVFS
FFGIIVSAMLCLGVHNNNEMLFLPFLVFTPIWIIVHIFALTVYSFNTIII
ILTVITMLLLVYAWLVVWSYYIELLFAYEDELETGYV*

MIP14249.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-PA 160 CG42288-PA 1..160 28..187 856 100 Plus
CG42288-PB 157 CG42288-PB 1..157 28..187 830 98.1 Plus

MIP14249.pep Sequence

Translation from 2 to 565

> MIP14249.pep
FQQISVSQESFENCCLKLAVRLRIGSIMACRCKYLKQIFTKCCYCYSLRF
GVLLFGCIFLTWFIYITIGTGFMMECIFPNEYQRSLIPAPAALKATMVFS
FFGIIVSAMLCLGVHNNNEMLFLPFLVFTPIWIIVHIFALTVYSFNTIII
ILTVITMLLLVYAWLVVWSYYIELLFAYEDELETGYV*

MIP14249.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20422-PA 164 GG20422-PA 94..164 117..187 326 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22674-PA 162 GH22674-PA 1..154 28..181 546 63 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42288-PA 160 CG42288-PA 1..160 28..187 856 100 Plus
CG42288-PB 157 CG42288-PB 1..157 28..187 830 98.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21185-PA 209 GI21185-PA 43..209 21..187 553 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11246-PA 286 GL11246-PA 127..286 28..187 574 66.2 Plus
Dper\GL11738-PA 101 GL11738-PA 27..90 53..116 262 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24659-PA 160 GA24659-PA 1..160 28..187 572 66.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21508-PA 255 GM21508-PA 92..255 24..187 834 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11002-PA 122 GD11002-PA 3..122 39..187 162 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21041-PA 161 GJ21041-PA 1..154 28..181 503 61 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22082-PA 239 GK22082-PA 77..233 25..182 562 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13553-PA 255 GE13553-PA 85..255 18..187 785 88.3 Plus