MIP14311.complete Sequence
601 bp assembled on 2009-09-28
GenBank Submission: BT099879.1
> MIP14311.complete
AAAATAAACAAATCAAAATGGCAGTCGGCTTCATTGTAATCTTCAGCGCC
ATATTCGTCCTGGCCCAAGGATCAAATCTTTTGCCCATTGAGCAGCAATC
GGAGGTGCCAATCCATTCTGGTGCTCCAGCGGCAGTCATTTCGCAAGGAC
AACAGTCTGTGTCCCAGTCCGTTGGTTCTGCTTACGGTCAAGACCAAGGG
TTGGCTGGTGCACGACCCTATTGGGCTGCACCTCGTCCTGCTCTGGCTGC
ACCTCGTCCTGCTGAGTCCTACGCTCGTCCTGCTGTGGCTGTACCTCGTC
CTTCTGTGGCTGCACCTCGTCCGGCTGTGTCCTACGCTCGTCCTGCAGCC
GTGGTGGTTCCTGCTTTGGTGGTTGCTCCTATTCGCCAGCCTCAGGGAGT
CCCTGTCCCAGCCGTTGTAGGAGCTAGTCAAGGAAATGTGTACCATGGTC
GCCATCATGGCTAAGCGTCGTGCAAATACTCTGCTCGAATCTCTTCCGGT
TGACACACATTTTGGAACCAATTAATATTTACTTCTACAAATAATATTAA
CATAAATAAAAAAAAAAATGGAAAACAAAAAAAAAAAAAAAAAAAAAAAA
A
MIP14311.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33333-RA | 540 | CG33333-RA | 1..540 | 14..553 | 2700 | 100 | Plus |
nc_17366.a | 479 | nc_17366.a | 1..309 | 553..245 | 1545 | 100 | Minus |
nc_17366.a | 479 | nc_17366.a | 291..479 | 242..54 | 945 | 100 | Minus |
nc_17366.a | 479 | nc_17366.a | 208..267 | 283..224 | 225 | 91.6 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13241828..13242391 | 1..564 | 2715 | 98.8 | Plus |
chr3R | 27901430 | chr3R | 13242051..13242110 | 287..346 | 255 | 95 | Plus |
chr3R | 27901430 | chr3R | 13242114..13242173 | 224..283 | 225 | 91.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:10:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17417467..17418045 | 1..579 | 2895 | 100 | Plus |
3R | 32079331 | 3R | 17417690..17417749 | 287..346 | 225 | 91.7 | Plus |
3R | 32079331 | 3R | 17417753..17417812 | 224..283 | 225 | 91.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17158298..17158876 | 1..579 | 2895 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 07:10:37 has no hits.
MIP14311.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:28 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13241828..13242361 | 1..534 | 98 | <- | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:52 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..447 | 18..464 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:54 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..447 | 18..464 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:20 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..447 | 18..464 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:34 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..447 | 18..464 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 13:48:43 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..447 | 18..464 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:53 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..551 | 1..551 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:20 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..551 | 1..551 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:34 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33333-RA | 1..551 | 1..551 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17417467..17418017 | 1..551 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17417467..17418017 | 1..551 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17417467..17418017 | 1..551 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:20 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13243189..13243739 | 1..551 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:38 Download gff for
MIP14311.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17158298..17158848 | 1..551 | 100 | | Plus |
MIP14311.hyp Sequence
Translation from 2 to 463
> MIP14311.hyp
NKQIKMAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQ
QSVSQSVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRP
SVAAPRPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGR
HHG*
MIP14311.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33333-PA | 148 | CG33333-PA | 1..148 | 6..153 | 750 | 100 | Plus |
CG42834-PA | 122 | CG42834-PA | 1..103 | 6..93 | 139 | 36.1 | Plus |
MIP14311.pep Sequence
Translation from 2 to 463
> MIP14311.pep
NKQIKMAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQ
QSVSQSVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRP
SVAAPRPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGR
HHG*
MIP14311.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:53:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22235-PA | 153 | GG22235-PA | 1..153 | 6..153 | 358 | 58.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33333-PA | 148 | CG33333-PA | 1..148 | 6..153 | 750 | 100 | Plus |
CG42834-PA | 122 | CG42834-PA | 1..103 | 6..93 | 139 | 36.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:53:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15232-PA | 155 | GM15232-PA | 1..155 | 6..153 | 426 | 71.6 | Plus |
Dsec\GM15235-PA | 148 | GM15235-PA | 1..144 | 6..153 | 223 | 40.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:53:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19158-PA | 148 | GD19158-PA | 1..148 | 6..153 | 423 | 72.2 | Plus |
Dsim\GD19160-PA | 148 | GD19160-PA | 1..144 | 6..153 | 219 | 40.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:53:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10132-PA | 139 | GE10132-PA | 1..139 | 6..153 | 299 | 53 | Plus |
Dyak\GE10134-PA | 150 | GE10134-PA | 1..146 | 6..153 | 201 | 39.2 | Plus |