Clone MIP14311 Report

Search the DGRC for MIP14311

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:11
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG33333-RA
Protein status:MIP14311.pep: gold
Sequenced Size:601

Clone Sequence Records

MIP14311.complete Sequence

601 bp assembled on 2009-09-28

GenBank Submission: BT099879.1

> MIP14311.complete
AAAATAAACAAATCAAAATGGCAGTCGGCTTCATTGTAATCTTCAGCGCC
ATATTCGTCCTGGCCCAAGGATCAAATCTTTTGCCCATTGAGCAGCAATC
GGAGGTGCCAATCCATTCTGGTGCTCCAGCGGCAGTCATTTCGCAAGGAC
AACAGTCTGTGTCCCAGTCCGTTGGTTCTGCTTACGGTCAAGACCAAGGG
TTGGCTGGTGCACGACCCTATTGGGCTGCACCTCGTCCTGCTCTGGCTGC
ACCTCGTCCTGCTGAGTCCTACGCTCGTCCTGCTGTGGCTGTACCTCGTC
CTTCTGTGGCTGCACCTCGTCCGGCTGTGTCCTACGCTCGTCCTGCAGCC
GTGGTGGTTCCTGCTTTGGTGGTTGCTCCTATTCGCCAGCCTCAGGGAGT
CCCTGTCCCAGCCGTTGTAGGAGCTAGTCAAGGAAATGTGTACCATGGTC
GCCATCATGGCTAAGCGTCGTGCAAATACTCTGCTCGAATCTCTTCCGGT
TGACACACATTTTGGAACCAATTAATATTTACTTCTACAAATAATATTAA
CATAAATAAAAAAAAAAATGGAAAACAAAAAAAAAAAAAAAAAAAAAAAA
A

MIP14311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-RA 540 CG33333-RA 1..540 14..553 2700 100 Plus
nc_17366.a 479 nc_17366.a 1..309 553..245 1545 100 Minus
nc_17366.a 479 nc_17366.a 291..479 242..54 945 100 Minus
nc_17366.a 479 nc_17366.a 208..267 283..224 225 91.6 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13241828..13242391 1..564 2715 98.8 Plus
chr3R 27901430 chr3R 13242051..13242110 287..346 255 95 Plus
chr3R 27901430 chr3R 13242114..13242173 224..283 225 91.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17417467..17418045 1..579 2895 100 Plus
3R 32079331 3R 17417690..17417749 287..346 225 91.7 Plus
3R 32079331 3R 17417753..17417812 224..283 225 91.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17158298..17158876 1..579 2895 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:10:37 has no hits.

MIP14311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:28 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13241828..13242361 1..534 98 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:52 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..447 18..464 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:54 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..447 18..464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:20 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..447 18..464 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:34 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..447 18..464 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 13:48:43 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..447 18..464 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:53 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:20 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..551 1..551 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:34 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 1..551 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17417467..17418017 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17417467..17418017 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:28 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17417467..17418017 1..551 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:20 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13243189..13243739 1..551 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:38 Download gff for MIP14311.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17158298..17158848 1..551 100   Plus

MIP14311.hyp Sequence

Translation from 2 to 463

> MIP14311.hyp
NKQIKMAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQ
QSVSQSVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRP
SVAAPRPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGR
HHG*

MIP14311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-PA 148 CG33333-PA 1..148 6..153 750 100 Plus
CG42834-PA 122 CG42834-PA 1..103 6..93 139 36.1 Plus

MIP14311.pep Sequence

Translation from 2 to 463

> MIP14311.pep
NKQIKMAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQ
QSVSQSVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRP
SVAAPRPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGR
HHG*

MIP14311.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22235-PA 153 GG22235-PA 1..153 6..153 358 58.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-PA 148 CG33333-PA 1..148 6..153 750 100 Plus
CG42834-PA 122 CG42834-PA 1..103 6..93 139 36.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15232-PA 155 GM15232-PA 1..155 6..153 426 71.6 Plus
Dsec\GM15235-PA 148 GM15235-PA 1..144 6..153 223 40.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19158-PA 148 GD19158-PA 1..148 6..153 423 72.2 Plus
Dsim\GD19160-PA 148 GD19160-PA 1..144 6..153 219 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10132-PA 139 GE10132-PA 1..139 6..153 299 53 Plus
Dyak\GE10134-PA 150 GE10134-PA 1..146 6..153 201 39.2 Plus