Clone MIP14317 Report

Search the DGRC for MIP14317

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:17
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42728-RA
Protein status:MIP14317.pep: gold
Sequenced Size:613

Clone Sequence Records

MIP14317.complete Sequence

613 bp assembled on 2011-03-11

GenBank Submission: BT126307.1

> MIP14317.complete
GAATGCAGCAATCTTTGCGCGTGGAACTGCTATTGATCGTTTACGGGTTG
ATTCTCGTTGTCTGGGGAATCAATGGATTAAACATACCCGAGTGCAGTGG
CCAGAATGGATTTATTAACAATACGCGATCCAATTGCAATTACTCCCTCA
TCAATTGCTCTGGCCAGAACTCGATGTTCTGCACGGACAACACGACCTGC
AATGCCAACTTCACCTGTAGCGACATACTTCCGGTGGATAATTCAACAGC
ACTACCCATAAGCACAACTCCCAATGTGGTAACCACAGCCTCGACAACTG
TTTCACCTTCCGATATTCGACGAGAGTGTCGTCAGGGTGTTACCAAAAGA
TTTAGCTATCCGCAGAATTGTAACTACTTCTACTATTGCGTTGATGGCTT
TCTGCTGGTGGAGCAATGTCCTATTGGCTACGCATTCGATCCCCAAACTG
GAGCTTGTGGTGGACGTACGTAATCGCTCCAGCGATTGTACTTTAAAGTG
AAAATAATCGCACCAAACTTTTAATTAAGCCTCTTGTCGTGTCAAATTAA
ACAATTATAGCTAGAAAATAAAAATGAATTTAGAGTCTTATCAGAGAAAA
AAAAAAAAAAAAA

MIP14317.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15517526..15518123 596..1 2910 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15527586..15528183 598..1 2990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15520686..15521283 598..1 2990 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:46 has no hits.

MIP14317.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:29 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15517526..15518123 1..596 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-11 14:24:49 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 1..471 3..473 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:55:14 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 1..471 3..473 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:32 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 1..471 3..473 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-11 14:24:48 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 14..577 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:55:14 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 14..577 1..564 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:32 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
CG42728-RA 14..577 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:29 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15527588..15528183 1..596 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:29 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15527588..15528183 1..596 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:29 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15527588..15528183 1..596 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:55:14 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15520688..15521283 1..596 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:13 Download gff for MIP14317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15520688..15521283 1..596 100   Minus

MIP14317.hyp Sequence

Translation from 2 to 472

> MIP14317.hyp
MQQSLRVELLLIVYGLILVVWGINGLNIPECSGQNGFINNTRSNCNYSLI
NCSGQNSMFCTDNTTCNANFTCSDILPVDNSTALPISTTPNVVTTASTTV
SPSDIRRECRQGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTG
ACGGRT*

MIP14317.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42728-PA 156 CG42728-PA 1..156 1..156 850 100 Plus
CG42729-PA 185 CG42729-PA 4..172 10..152 163 28.2 Plus

MIP14317.pep Sequence

Translation from 2 to 472

> MIP14317.pep
MQQSLRVELLLIVYGLILVVWGINGLNIPECSGQNGFINNTRSNCNYSLI
NCSGQNSMFCTDNTTCNANFTCSDILPVDNSTALPISTTPNVVTTASTTV
SPSDIRRECRQGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTG
ACGGRT*

MIP14317.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24465-PA 162 GF24465-PA 1..152 1..155 488 61.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13540-PA 274 GG13540-PA 1..96 58..153 380 89.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16814-PA 315 GH16814-PA 1..106 58..152 204 40.7 Plus
Dgri\GH16815-PA 281 GH16815-PA 204..261 92..152 141 39.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42728-PA 156 CG42728-PA 1..156 1..156 850 100 Plus
CG42729-PA 185 CG42729-PA 4..172 10..152 163 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12217-PA 172 GI12217-PA 1..161 1..155 312 42.2 Plus
Dmoj\GI12219-PA 271 GI12219-PA 178..255 70..152 149 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25562-PA 173 GL25562-PA 1..164 1..156 482 61 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23636-PA 175 GA23636-PA 1..166 1..156 481 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24483-PA 277 GM24483-PA 1..97 58..154 498 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17571-PA 165 GD17571-PA 1..155 1..155 774 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11449-PA 228 GJ11449-PA 2..37 119..154 150 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10517-PA 167 GK10517-PA 1..159 1..154 230 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19841-PA 277 GE19841-PA 1..96 58..153 476 93.8 Plus
Dyak\GE22839-PA 277 GE22839-PA 1..96 58..153 472 92.7 Plus