Clone MIP14343 Report

Search the DGRC for MIP14343

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:43
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34454-RA
Protein status:MIP14343.pep: gold
Sequenced Size:647

Clone Sequence Records

MIP14343.complete Sequence

647 bp assembled on 2009-09-28

GenBank Submission: BT099893.1

> MIP14343.complete
CAGCGAACGAAAGCACATACGACTATAAGCTTCAGGATTCAGTTAAAGAT
GTGCATCAATTGGCATCCAATATTTATTTTTGCTTGTTTAAGTCAGTTGG
GCGCAGCCCAAGAACCTTTAATTTTCGAAACATCTCGTAGCCCATGGAAC
AATGCCGCCGCAACGACGTCAATACCAATTTCGCCCACCAGCGCAAACTT
AGTTTTGGTTAACAATGTAAGAATACCAGGAGGTCTTACACCATTTGTAC
CAGCACCGGCCCCAACCAAGGAATTTCTGAACTGCTTTGGTAACTGTCCC
ACCACATCGCAATACAATCCCATTTGCGGCAGCAATATGCAGCTTTATAT
GAACGAGGAAAAATTTAATTGTGCTCGTTTCTGTGGAGCTGACATTCAAA
TAGTTCGAAGAGGTTCTTGTGAGGGTCTTTTTGCGATGACGCGAGGTTGA
TATGCAACAACCAGCTATTTAATGTAATAGATTAATATACTCCAACTAAG
ATATTTTCAGTTTAAATATTATTATGGCACAGAGATAAGACGCCACGCAG
TACATAACAACGCAAAATAATATAAATAAAATAAATACATACTAATGCAA
AACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14343.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-RA 646 CG34454-RA 49..646 1..598 2990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 231915..232305 391..1 1955 100 Minus
chr3L 24539361 chr3L 231636..231848 603..391 1065 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 231960..232350 391..1 1955 100 Minus
3L 28110227 3L 231679..231893 605..391 1075 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 231960..232350 391..1 1955 100 Minus
3L 28103327 3L 231679..231893 605..391 1075 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:59:50 has no hits.

MIP14343.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:00:29 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 231915..232305 1..391 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:02 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..402 49..450 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:24 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..402 49..450 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:15 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..402 49..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:54:27 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..402 49..450 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 16:18:05 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..499 49..547 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:24 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..603 1..603 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:15 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..603 1..603 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:54:27 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
CG34454-RA 1..603 1..603 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:29 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 231681..231892 392..603 100 <- Minus
3L 231960..232350 1..391 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:29 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 231681..231892 392..603 100 <- Minus
3L 231960..232350 1..391 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:00:29 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 231681..231892 392..603 100 <- Minus
3L 231960..232350 1..391 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:15 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 231681..231892 392..603 100 <- Minus
arm_3L 231960..232350 1..391 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:00 Download gff for MIP14343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 231681..231892 392..603 100 <- Minus
3L 231960..232350 1..391 100   Minus

MIP14343.hyp Sequence

Translation from 0 to 449

> MIP14343.hyp
QRTKAHTTISFRIQLKMCINWHPIFIFACLSQLGAAQEPLIFETSRSPWN
NAAATTSIPISPTSANLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCP
TTSQYNPICGSNMQLYMNEEKFNCARFCGADIQIVRRGSCEGLFAMTRG*

MIP14343.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-PA 133 CG34454-PA 1..133 17..149 726 100 Plus
Kaz1-ORFB-PF 114 CG1220-PF 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PE 114 CG1220-PE 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PA 114 CG1220-PA 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PH 115 CG1220-PH 1..101 19..129 171 39.5 Plus

MIP14343.pep Sequence

Translation from 0 to 449

> MIP14343.pep
QRTKAHTTISFRIQLKMCINWHPIFIFACLSQLGAAQEPLIFETSRSPWN
NAAATTSIPISPTSANLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCP
TTSQYNPICGSNMQLYMNEEKFNCARFCGADIQIVRRGSCEGLFAMTRG*

MIP14343.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24746-PA 119 GF24746-PA 70..119 91..140 156 56 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14702-PA 112 GG14702-PA 61..112 89..140 138 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21757-PA 236 GH21757-PA 1..114 17..132 289 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34454-PA 133 CG34454-PA 1..133 17..149 726 100 Plus
Kaz1-ORFB-PF 114 CG1220-PF 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PE 114 CG1220-PE 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PA 114 CG1220-PA 1..113 19..141 194 38.9 Plus
Kaz1-ORFB-PH 115 CG1220-PH 1..101 19..129 171 39.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17274-PA 133 GI17274-PA 5..133 13..149 349 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16102-PA 469 GL16102-PA 155..273 15..132 287 55.4 Plus
Dper\GL16115-PA 109 GL16115-PA 58..107 92..141 132 48 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28492-PA 313 GA28492-PA 166..313 24..149 344 54 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14292-PA 424 GM14292-PA 138..270 1..132 644 91 Plus
Dsec\GM14318-PA 114 GM14318-PA 1..113 19..141 173 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13530-PA 426 GD13530-PA 138..270 1..132 666 94 Plus
Dsim\GD13556-PA 114 GD13556-PA 1..113 19..141 179 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22810-PA 247 GJ22810-PA 19..117 31..132 246 53.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11275-PA 280 GK11275-PA 184..280 36..133 299 58.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21037-PA 433 GE21037-PA 152..274 10..132 508 78.9 Plus
Dyak\GE21065-PA 112 GE21065-PA 47..112 77..140 155 50 Plus