Clone MIP14344 Report

Search the DGRC for MIP14344

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:44
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34460-RA
Protein status:MIP14344.pep: gold
Sequenced Size:743

Clone Sequence Records

MIP14344.complete Sequence

743 bp assembled on 2009-09-28

GenBank Submission: BT099857.1

> MIP14344.complete
AAAGTAAACCCATTACTCCGATTGAGATGAAGTGCCTCCTGGTGACGATA
GCCTGTTTGATCACGTGCTCCAGTGTGGGTGCCCTCGTGCACTATATGAA
ACTGGAAAAAGGAAAGAACGGATGCAAATCGCCCAAGGGTACAGAGATGG
CTGTGGGTGCTGTTGAGCAGGATGAAAAGACTTGTGGAGCTCTTACTTGT
CAAAATACGGAAGGGGATGCCTTCATCCACTACTGTCAGATACCTGCCTC
TTTTGCGGAATGTGTGGAGACCGCTGTTCTGACGGACGTTGACTTTCCAC
AATGCTGTTGGACTTGTGCCGATTGGGCGGACTGCGATGGAGAAGAACCT
GGACCAGGGGATGAAGCTCCTGCTGCCGACGGAGCTGCTGACGCACCACC
TCCTGCTGCAAGAACCCATGCAAGAAATTCTAAGTACCAGGCAACTACAA
CTGATACTACAGAAAGTGAAAGGCCACGCAGCAAAGGAAAATGGGGTTCC
AAGAGGAGCACTACCACATCCGATGAATCCGAATTTCCCGAGGGAATCAA
TATAAGGTTTGGCGGTGGAACACCGATCTCCAAGTTTGGCGAAGACAGCA
TTTAAGCTCAGATGCCGGCATATGTTTTGAGGAGCATCCCTAGTTATTAA
TTTAATGCTCGATTCCGATCGTAAATAAATGACACGGCAATGTGCACTTC
ATTTGTCTCCTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34460-RA 951 CG34460-RA 173..890 1..718 3575 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12714457..12714936 233..712 2385 99.8 Plus
chr2R 21145070 chr2R 12714225..12714342 115..232 590 100 Plus
chr2R 21145070 chr2R 12714055..12714168 1..114 570 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16827274..16827759 233..718 2415 99.8 Plus
2R 25286936 2R 16827042..16827159 115..232 590 100 Plus
2R 25286936 2R 16826872..16826985 1..114 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16828473..16828958 233..718 2415 99.7 Plus
2R 25260384 2R 16828241..16828358 115..232 590 100 Plus
2R 25260384 2R 16828071..16828184 1..114 570 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:00:04 has no hits.

MIP14344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:01:25 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12714055..12714168 1..114 100 -> Plus
chr2R 12714225..12714342 115..232 100 -> Plus
chr2R 12714457..12714938 233..714 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:33 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:10 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:13 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:21 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..579 27..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:34:02 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..689 26..714 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:10 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..689 26..714 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:13 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..714 1..714 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:21 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34460-RA 1..714 1..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:25 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16827274..16827755 233..714 99   Plus
2R 16826872..16826985 1..114 100 -> Plus
2R 16827042..16827159 115..232 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:25 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16827274..16827755 233..714 99   Plus
2R 16826872..16826985 1..114 100 -> Plus
2R 16827042..16827159 115..232 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:25 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16827274..16827755 233..714 99   Plus
2R 16826872..16826985 1..114 100 -> Plus
2R 16827042..16827159 115..232 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:13 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12714377..12714490 1..114 100 -> Plus
arm_2R 12714547..12714664 115..232 100 -> Plus
arm_2R 12714779..12715260 233..714 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:13 Download gff for MIP14344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16828473..16828954 233..714 99   Plus
2R 16828071..16828184 1..114 100 -> Plus
2R 16828241..16828358 115..232 100 -> Plus

MIP14344.hyp Sequence

Translation from 2 to 604

> MIP14344.hyp
SKPITPIEMKCLLVTIACLITCSSVGALVHYMKLEKGKNGCKSPKGTEMA
VGAVEQDEKTCGALTCQNTEGDAFIHYCQIPASFAECVETAVLTDVDFPQ
CCWTCADWADCDGEEPGPGDEAPAADGAADAPPPAARTHARNSKYQATTT
DTTESERPRSKGKWGSKRSTTTSDESEFPEGINIRFGGGTPISKFGEDSI
*

MIP14344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34460-PA 192 CG34460-PA 1..192 9..200 1049 100 Plus

MIP14344.pep Sequence

Translation from 2 to 604

> MIP14344.pep
SKPITPIEMKCLLVTIACLITCSSVGALVHYMKLEKGKNGCKSPKGTEMA
VGAVEQDEKTCGALTCQNTEGDAFIHYCQIPASFAECVETAVLTDVDFPQ
CCWTCADWADCDGEEPGPGDEAPAADGAADAPPPAARTHARNSKYQATTT
DTTESERPRSKGKWGSKRSTTTSDESEFPEGINIRFGGGTPISKFGEDSI
*

MIP14344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11413-PA 470 GF11413-PA 298..458 40..199 327 42.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20633-PA 462 GG20633-PA 292..462 38..200 613 72.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20744-PA 272 GH20744-PA 128..201 38..111 226 52.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34460-PA 192 CG34460-PA 1..192 9..200 1049 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20829-PA 161 GI20829-PA 20..117 27..115 243 48.5 Plus
Dmoj\GI18756-PA 108 GI18756-PA 5..100 27..116 163 37.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17739-PA 409 GL17739-PA 313..384 40..112 218 54.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27677-PA 402 GA27677-PA 309..402 40..134 225 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21727-PA 455 GM21727-PA 285..455 38..200 616 76.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11222-PA 470 GD11222-PA 301..470 39..200 665 81.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20562-PA 352 GJ20562-PA 261..349 45..133 216 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22021-PA 418 GK22021-PA 307..378 39..111 220 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11823-PA 449 GE11823-PA 288..449 38..200 578 71.5 Plus