Clone MIP14426 Report

Search the DGRC for MIP14426

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:144
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptTaf12L-RA
Protein status:MIP14426.pep: gold
Sequenced Size:466

Clone Sequence Records

MIP14426.complete Sequence

466 bp assembled on 2011-03-11

GenBank Submission: BT126308.1

> MIP14426.complete
ATTAAATTAATTGAATCATGGATAGTAACATGGAACCTTGGTCCTTTGCC
CTCAATTTCGATGACAGCGATAAATCGTCGGATAACGAGAGCCACTCTTC
GACCAGATCCTCGAGCCGCTCCAGTGACACCAGCATAGACACCAGCTCCG
TGGAGAAGGAGCCAGCTAGCGTAATTGAGAGCCAGTCTGTCCCTGGCGGA
AGCTACGATATTATCTCCAAGACCAACATGCTGCAATTTGTGCAGAAAAT
CGATGCAAATTCATCGCTGGACGATCAAGGTTGCGATATGATGGCCAGAA
TAGCCGATGCCTTTGTTAACGACATATCCATGCGCATAGTTAAGTTGGCC
AAGTATCGAAAGAGCGACGTTAGCGTGCTGGACCTGAAGTTCATCCTCAA
GCGGGAGTTCAACATGGAGTTCCCAATTGAATAAATGTCTAAAAAAAAAA
AAAAAAAAAAAAAAAA

MIP14426.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4700113..4700342 439..210 1150 100 Minus
chr2L 23010047 chr2L 4700403..4700611 209..1 1045 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4700980..4701216 446..210 1155 99.2 Minus
2L 23513712 2L 4701277..4701485 209..1 1045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4700980..4701216 446..210 1155 99.1 Minus
2L 23513712 2L 4701277..4701485 209..1 1045 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:57 has no hits.

MIP14426.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:36 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4700112..4700342 210..440 99 <- Minus
chr2L 4700403..4700611 1..209 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-11 17:30:11 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 1..417 18..434 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:55:22 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 1..417 18..434 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:41 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 1..417 18..434 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-11 17:30:08 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 104..542 1..440 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:55:22 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 1..439 1..440 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:41 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12L-RA 1..439 1..440 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:36 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4701277..4701485 1..209 100   Minus
2L 4700986..4701216 210..440 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:36 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4701277..4701485 1..209 100   Minus
2L 4700986..4701216 210..440 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:36 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4701277..4701485 1..209 100   Minus
2L 4700986..4701216 210..440 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:55:22 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4700986..4701216 210..440 99 <- Minus
arm_2L 4701277..4701485 1..209 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:22 Download gff for MIP14426.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4700986..4701216 210..440 99 <- Minus
2L 4701277..4701485 1..209 100   Minus

MIP14426.hyp Sequence

Translation from 17 to 433

> MIP14426.hyp
MDSNMEPWSFALNFDDSDKSSDNESHSSTRSSSRSSDTSIDTSSVEKEPA
SVIESQSVPGGSYDIISKTNMLQFVQKIDANSSLDDQGCDMMARIADAFV
NDISMRIVKLAKYRKSDVSVLDLKFILKREFNMEFPIE*

MIP14426.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12L-PA 138 CG15632-PA 1..138 1..138 690 100 Plus

MIP14426.pep Sequence

Translation from 17 to 433

> MIP14426.pep
MDSNMEPWSFALNFDDSDKSSDNESHSSTRSSSRSSDTSIDTSSVEKEPA
SVIESQSVPGGSYDIISKTNMLQFVQKIDANSSLDDQGCDMMARIADAFV
NDISMRIVKLAKYRKSDVSVLDLKFILKREFNMEFPIE*

MIP14426.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23906-PA 139 GF23906-PA 57..131 61..135 285 68 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24357-PA 138 GG24357-PA 5..138 4..138 489 80 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13137-PA 132 GH13137-PA 55..126 65..136 227 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12L-PA 138 CG15632-PA 1..138 1..138 690 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22859-PA 212 GI22859-PA 129..202 63..136 254 62.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15975-PA 127 GL15975-PA 37..116 56..136 143 40.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26102-PA 127 GA26102-PA 37..116 56..136 143 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18077-PA 138 GM18077-PA 4..138 3..138 539 89.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22694-PA 90 GD22694-PA 4..89 3..89 288 88.5 Plus
Dsim\GD22695-PA 47 GD22695-PA 1..47 92..138 225 91.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23407-PA 137 GJ23407-PA 56..131 61..136 267 63.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19084-PA 81 GK19084-PA 1..72 65..136 191 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14689-PA 138 GE14689-PA 5..138 4..138 454 75.6 Plus