BDGP Sequence Production Resources |
Search the DGRC for MIP14506
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 145 |
Well: | 6 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | Os-C-RC |
Protein status: | MIP14506.pep: gold |
Sequenced Size: | 576 |
576 bp assembled on 2009-09-28
GenBank Submission: BT099867.1
> MIP14506.complete AACCAAGTTGACAAAATGGGTTTTCACATGGGACGACAGCTGCTACTCTC CGGATTCCTGCTGGTGATGCTTCAGATGGTGACCCAAACGCAGGCCAGGC CGCAGGATGTGATCACAGTTGCTGGCGAGGAGACAGAGGTGGTGATCAAG CGGGAGGGCGATGACGATGGAGACGACGATGACTCCTCCTCCGAGGAAAC AGTCGAGGATTCCGAGGAAAGCAGACGCAGACGACGCGAGGTGAATACGG ACAACACGCCATCGGCTCGAGCGGTTATTCCAGGCGAGCAAGTAGTCCCC ATTCTCTTGGAGGCCATTCTTCCCAGCGTGGATGCAGCGGGCGATCGCTT CGCAAGATCTGTGCAATTTCTGAAAAACTTGACCCCTGGCTCTGAATTGT TTGCCGTCGAGAAGAACGAATAGCCGAGCCAAATTTAATGTGACTACCAT TGAAGGAACTGGACCGGAATTGATTTGACTTTTGTATCTGCATAGTGAAT CTTAAACAAGTGAATAATATTTGGATGTAGTTTGGTTTCTTGAGTTTCTG AAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Os-C.b | 911 | Os-C.b | 153..706 | 1..554 | 2755 | 99.8 | Plus |
Os-C-RC | 956 | Os-C-RC | 198..751 | 1..554 | 2755 | 99.8 | Plus |
Os-C-RB | 761 | Os-C-RB | 193..476 | 1..284 | 1420 | 100 | Plus |
Os-C-RB | 761 | Os-C-RB | 528..761 | 282..515 | 1170 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 3805394..3805661 | 282..549 | 1340 | 100 | Plus |
chr3R | 27901430 | chr3R | 3805161..3805342 | 103..284 | 910 | 100 | Plus |
chr3R | 27901430 | chr3R | 3805007..3805112 | 1..106 | 515 | 99.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 3805007..3805111 | 1..105 | 99 | -> | Plus |
chr3R | 3805164..3805341 | 106..283 | 100 | -> | Plus |
chr3R | 3805396..3805661 | 284..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 1..408 | 16..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 1..408 | 16..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 1..408 | 16..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 1..408 | 16..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 2..550 | 1..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 2..550 | 1..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 2..550 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Os-C-RC | 2..550 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7978960..7979064 | 1..105 | 100 | -> | Plus |
3R | 7979117..7979294 | 106..283 | 100 | -> | Plus |
3R | 7979349..7979614 | 284..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7978960..7979064 | 1..105 | 100 | -> | Plus |
3R | 7979117..7979294 | 106..283 | 100 | -> | Plus |
3R | 7979349..7979614 | 284..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7978960..7979064 | 1..105 | 100 | -> | Plus |
3R | 7979117..7979294 | 106..283 | 100 | -> | Plus |
3R | 7979349..7979614 | 284..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 3804682..3804786 | 1..105 | 100 | -> | Plus |
arm_3R | 3804839..3805016 | 106..283 | 100 | -> | Plus |
arm_3R | 3805071..3805336 | 284..550 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 7720180..7720445 | 284..550 | 99 | Plus | |
3R | 7719791..7719895 | 1..105 | 100 | -> | Plus |
3R | 7719948..7720125 | 106..283 | 100 | -> | Plus |
Translation from 0 to 422
> MIP14506.hyp NQVDKMGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIK REGDDDGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVP ILLEAILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNE*
Translation from 0 to 422
> MIP14506.pep NQVDKMGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIK REGDDDGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVP ILLEAILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18454-PA | 126 | GF18454-PA | 1..113 | 6..122 | 237 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14307-PA | 135 | GG14307-PA | 1..135 | 6..140 | 490 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17643-PA | 142 | GH17643-PA | 1..134 | 6..135 | 194 | 41.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Os-C-PC | 135 | CG3250-PC | 1..135 | 6..140 | 670 | 100 | Plus |
Os-C-PB | 153 | CG3250-PB | 1..153 | 6..140 | 641 | 88.2 | Plus |
Os-C-PD | 131 | CG3250-PD | 1..131 | 6..140 | 635 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23968-PA | 139 | GL23968-PA | 1..139 | 6..139 | 270 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26464-PA | 139 | GA26464-PA | 1..139 | 6..139 | 278 | 61.9 | Plus |
Dpse\GA26464-PB | 157 | GA26464-PB | 1..157 | 6..139 | 249 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10988-PA | 135 | GM10988-PA | 1..135 | 6..140 | 520 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19960-PA | 135 | GD19960-PA | 1..135 | 6..140 | 520 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12955-PA | 134 | GK12955-PA | 1..128 | 6..137 | 222 | 53.3 | Plus |