Clone MIP14506 Report

Search the DGRC for MIP14506

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:145
Well:6
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptOs-C-RC
Protein status:MIP14506.pep: gold
Sequenced Size:576

Clone Sequence Records

MIP14506.complete Sequence

576 bp assembled on 2009-09-28

GenBank Submission: BT099867.1

> MIP14506.complete
AACCAAGTTGACAAAATGGGTTTTCACATGGGACGACAGCTGCTACTCTC
CGGATTCCTGCTGGTGATGCTTCAGATGGTGACCCAAACGCAGGCCAGGC
CGCAGGATGTGATCACAGTTGCTGGCGAGGAGACAGAGGTGGTGATCAAG
CGGGAGGGCGATGACGATGGAGACGACGATGACTCCTCCTCCGAGGAAAC
AGTCGAGGATTCCGAGGAAAGCAGACGCAGACGACGCGAGGTGAATACGG
ACAACACGCCATCGGCTCGAGCGGTTATTCCAGGCGAGCAAGTAGTCCCC
ATTCTCTTGGAGGCCATTCTTCCCAGCGTGGATGCAGCGGGCGATCGCTT
CGCAAGATCTGTGCAATTTCTGAAAAACTTGACCCCTGGCTCTGAATTGT
TTGCCGTCGAGAAGAACGAATAGCCGAGCCAAATTTAATGTGACTACCAT
TGAAGGAACTGGACCGGAATTGATTTGACTTTTGTATCTGCATAGTGAAT
CTTAAACAAGTGAATAATATTTGGATGTAGTTTGGTTTCTTGAGTTTCTG
AAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14506.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C.b 911 Os-C.b 153..706 1..554 2755 99.8 Plus
Os-C-RC 956 Os-C-RC 198..751 1..554 2755 99.8 Plus
Os-C-RB 761 Os-C-RB 193..476 1..284 1420 100 Plus
Os-C-RB 761 Os-C-RB 528..761 282..515 1170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3805394..3805661 282..549 1340 100 Plus
chr3R 27901430 chr3R 3805161..3805342 103..284 910 100 Plus
chr3R 27901430 chr3R 3805007..3805112 1..106 515 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7979347..7979619 282..554 1350 99.6 Plus
3R 32079331 3R 7979114..7979295 103..284 910 100 Plus
3R 32079331 3R 7978960..7979065 1..106 530 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7720178..7720450 282..554 1350 99.6 Plus
3R 31820162 3R 7719945..7720126 103..284 910 100 Plus
3R 31820162 3R 7719791..7719896 1..106 530 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:07:11 has no hits.

MIP14506.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:07:55 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3805007..3805111 1..105 99 -> Plus
chr3R 3805164..3805341 106..283 100 -> Plus
chr3R 3805396..3805661 284..550 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:26 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 1..408 16..423 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:24 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 1..408 16..423 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:00 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 1..408 16..423 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:54 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 1..408 16..423 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:33:51 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 2..550 1..550 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:24 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 2..550 1..550 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:00 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 2..550 1..549 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:54 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
Os-C-RC 2..550 1..549 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:55 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7978960..7979064 1..105 100 -> Plus
3R 7979117..7979294 106..283 100 -> Plus
3R 7979349..7979614 284..550 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:55 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7978960..7979064 1..105 100 -> Plus
3R 7979117..7979294 106..283 100 -> Plus
3R 7979349..7979614 284..550 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:55 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7978960..7979064 1..105 100 -> Plus
3R 7979117..7979294 106..283 100 -> Plus
3R 7979349..7979614 284..550 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:00 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3804682..3804786 1..105 100 -> Plus
arm_3R 3804839..3805016 106..283 100 -> Plus
arm_3R 3805071..3805336 284..550 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:23 Download gff for MIP14506.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7720180..7720445 284..550 99   Plus
3R 7719791..7719895 1..105 100 -> Plus
3R 7719948..7720125 106..283 100 -> Plus

MIP14506.hyp Sequence

Translation from 0 to 422

> MIP14506.hyp
NQVDKMGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIK
REGDDDGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVP
ILLEAILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNE*

MIP14506.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C-PC 135 CG3250-PC 1..135 6..140 670 100 Plus
Os-C-PB 153 CG3250-PB 1..153 6..140 641 88.2 Plus
Os-C-PD 131 CG3250-PD 1..131 6..140 635 97 Plus

MIP14506.pep Sequence

Translation from 0 to 422

> MIP14506.pep
NQVDKMGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIK
REGDDDGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVP
ILLEAILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNE*

MIP14506.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18454-PA 126 GF18454-PA 1..113 6..122 237 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14307-PA 135 GG14307-PA 1..135 6..140 490 89.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17643-PA 142 GH17643-PA 1..134 6..135 194 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Os-C-PC 135 CG3250-PC 1..135 6..140 670 100 Plus
Os-C-PB 153 CG3250-PB 1..153 6..140 641 88.2 Plus
Os-C-PD 131 CG3250-PD 1..131 6..140 635 97 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23968-PA 139 GL23968-PA 1..139 6..139 270 61.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26464-PA 139 GA26464-PA 1..139 6..139 278 61.9 Plus
Dpse\GA26464-PB 157 GA26464-PB 1..157 6..139 249 54.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10988-PA 135 GM10988-PA 1..135 6..140 520 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19960-PA 135 GD19960-PA 1..135 6..140 520 95.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12955-PA 134 GK12955-PA 1..128 6..137 222 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24956-PA 133 GE24956-PA 1..133 6..140 489 90.4 Plus
Dyak\GE24957-PA 109 GE24957-PA 7..109 36..140 333 90.5 Plus