Clone MIP14517 Report

Search the DGRC for MIP14517

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:145
Well:17
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp23F-RA
Protein status:MIP14517.pep: gold
Sequenced Size:317

Clone Sequence Records

MIP14517.complete Sequence

317 bp assembled on 2009-09-28

GenBank Submission: BT099870.1

> MIP14517.complete
AATATATCTAAAATGCGTTTATATAAAATATTTTGCCTAATTTGTTCCAT
ATTTGGCTGTGTTTCAGCTTTAAAAGATCCGAGCTGTGCTGTTGAGTTGT
TTGGCCAAGGTGCTTGCAACACTTTGATTACTCGAATCGGCTATTTACGT
TGGGAAAACATGTGTACATCAAAGAACTTTGTTGCATGCGACACCGATGG
AACTTCATTTGAGAGCATTAAGGAATGCGAAGATAAATGCAAAGAGTAGT
CTTATGGCTGTAAAATAAAAAAACAATATTAAATATTTCAAAAAGTCACA
AAAAAAAAAAAAAAAAA

MIP14517.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-RA 376 Sfp23F-RA 71..370 1..300 1500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3386994..3387213 299..80 1100 100 Minus
chr2L 23010047 chr2L 3387282..3387360 79..1 365 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3387353..3387573 300..80 1105 100 Minus
2L 23513712 2L 3387642..3387720 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3387353..3387573 300..80 1105 100 Minus
2L 23513712 2L 3387642..3387720 79..1 395 100 Minus
2L 23513712 2L 3388336..3388371 75..40 135 91.6 Minus
Blast to na_te.dros performed 2019-03-16 07:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 4309..4362 287..230 110 69 Minus

MIP14517.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:11:10 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3387282..3387360 1..79 97   Minus
chr2L 3387036..3387213 80..257 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:44 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 1..237 13..249 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:33 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 1..237 13..249 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:07 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 1..237 13..249 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:16 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 1..237 13..249 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:18:45 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 24..284 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:33 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 24..284 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:07 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 24..322 1..299 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:16 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 24..322 1..299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:10 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387354..3387573 80..299 100 <- Minus
2L 3387642..3387720 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:10 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387354..3387573 80..299 100 <- Minus
2L 3387642..3387720 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:11:10 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387354..3387573 80..299 100 <- Minus
2L 3387642..3387720 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:07 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3387354..3387573 80..299 100 <- Minus
arm_2L 3387642..3387720 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:29 Download gff for MIP14517.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387354..3387573 80..299 100 <- Minus
2L 3387642..3387720 1..79 100   Minus

MIP14517.hyp Sequence

Translation from 0 to 248

> MIP14517.hyp
NISKMRLYKIFCLICSIFGCVSALKDPSCAVELFGQGACNTLITRIGYLR
WENMCTSKNFVACDTDGTSFESIKECEDKCKE*

MIP14517.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-PA 78 CG42459-PA 1..78 5..82 430 100 Plus
CG42460-PB 79 CG42460-PB 1..78 5..82 212 52.6 Plus
CG42460-PA 79 CG42460-PA 1..78 5..82 212 52.6 Plus

MIP14517.pep Sequence

Translation from 0 to 248

> MIP14517.pep
NISKMRLYKIFCLICSIFGCVSALKDPSCAVELFGQGACNTLITRIGYLR
WENMCTSKNFVACDTDGTSFESIKECEDKCKE*

MIP14517.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-PA 78 CG42459-PA 1..78 5..82 430 100 Plus
CG42460-PB 79 CG42460-PB 1..78 5..82 212 52.6 Plus
CG42460-PA 79 CG42460-PA 1..78 5..82 212 52.6 Plus