Clone MIP14606 Report

Search the DGRC for MIP14606

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:146
Well:6
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG9427-RB
Protein status:MIP14606.pep: gold
Sequenced Size:742

Clone Sequence Records

MIP14606.complete Sequence

742 bp assembled on 2009-10-12

GenBank Submission: BT100009.1

> MIP14606.complete
ATAATACTATCCTTTATGCTGTCTCTTCTGATATGGCAGACTTTCACATA
TTACTCGGTACTTGAAAATATATGCCAGGAAATCAAGGAGCAGCTTAAGT
TGAATATGAAACAGCTGCACATCACCCTCCTTTACGAGTCCTTGTGCCCG
GACAGCAGGAACTTCATGCATCAGCTAGGACCCGTTTACGAGGAGTTCGG
GGACTACATTGATATACTCTTAGTGCCCTTCGGAAAATCGCAGTCGGAGC
GCAATGGTGCCATCTTCCACTGCCAGCACGGACCGGCTGAGTGCAAGGGC
AATCGCCTCCAGAGTTGCGTCATCAACAGCACCGCAAACCAGGCGGCGCA
GGTTAAATTCGTGGTGTGCCAGATGCTAGCTCCGGATTATTCCCGCATTG
ATCAGTGTGCCAATGAGGCAGGCCTGCTCACCGATGTGGTCCACTGCCTG
TCCAGCGAGACGGGCACCAAATTGCAGCTGCAGGCGGAGCTGGTGACCAA
ACAGTACAGCCCGAGCTTCATTCCCACCATCGTCTACAATGGCGTCTTCG
ATCAGCAGCTGCAGGACCATTCGCTGCGCGATTTCCGCGGCACGGTTTGT
TATATGTTGCGTCAACAAAACTTGCTGCCCAGCAGCAGCACAATCTGCCA
GTAGATAGATCTGCTAAATGTCCAATGTAATTGCCTCAAGTTTGGAATGA
AATTAAAATTCATAAACGCAAAAAAAAAAAAAAAAAAAAAAA

MIP14606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9427.a 757 CG9427.a 35..754 1..720 3600 100 Plus
CG9427-RA 1031 CG9427-RA 354..961 113..720 3040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5451478..5451770 405..113 1465 100 Minus
chr3R 27901430 chr3R 5450968..5451141 717..544 870 100 Minus
chr3R 27901430 chr3R 5451234..5451376 545..403 715 100 Minus
chr3R 27901430 chr3R 5452626..5452739 114..1 570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9625669..9625961 405..113 1465 100 Minus
3R 32079331 3R 9625156..9625332 720..544 885 100 Minus
3R 32079331 3R 9625425..9625567 545..403 715 100 Minus
3R 32079331 3R 9626817..9626930 114..1 570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9366500..9366792 405..113 1465 100 Minus
3R 31820162 3R 9365987..9366163 720..544 885 100 Minus
3R 31820162 3R 9366256..9366398 545..403 715 100 Minus
3R 31820162 3R 9367648..9367761 114..1 570 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:35:38 has no hits.

MIP14606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:36:25 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5450965..5451141 544..719 98 <- Minus
chr3R 5451236..5451373 406..543 100 <- Minus
chr3R 5451478..5451768 115..405 100 <- Minus
chr3R 5452626..5452739 1..114 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:26 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RA 97..642 110..654 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:42:43 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RA 97..642 110..654 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:58:00 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RB 1..639 16..654 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:58 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RB 1..639 16..654 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-12 10:14:55 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RA 226..836 110..719 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:42:42 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RA 226..836 110..719 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:58:00 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RB 1..719 1..719 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:58 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
CG9427-RB 1..719 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:25 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9625157..9625332 544..719 100 <- Minus
3R 9625427..9625564 406..543 100 <- Minus
3R 9625669..9625959 115..405 100 <- Minus
3R 9626817..9626930 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:25 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9625157..9625332 544..719 100 <- Minus
3R 9625427..9625564 406..543 100 <- Minus
3R 9625669..9625959 115..405 100 <- Minus
3R 9626817..9626930 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:25 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9625157..9625332 544..719 100 <- Minus
3R 9625427..9625564 406..543 100 <- Minus
3R 9625669..9625959 115..405 100 <- Minus
3R 9626817..9626930 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:58:00 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5450879..5451054 544..719 100 <- Minus
arm_3R 5451149..5451286 406..543 100 <- Minus
arm_3R 5451391..5451681 115..405 100 <- Minus
arm_3R 5452539..5452652 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:55 Download gff for MIP14606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9366500..9366790 115..405 100 <- Minus
3R 9367648..9367761 1..114 100   Minus
3R 9365988..9366163 544..719 100 <- Minus
3R 9366258..9366395 406..543 100 <- Minus

MIP14606.pep Sequence

Translation from 0 to 653

> MIP14606.pep
IILSFMLSLLIWQTFTYYSVLENICQEIKEQLKLNMKQLHITLLYESLCP
DSRNFMHQLGPVYEEFGDYIDILLVPFGKSQSERNGAIFHCQHGPAECKG
NRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCL
SSETGTKLQLQAELVTKQYSPSFIPTIVYNGVFDQQLQDHSLRDFRGTVC
YMLRQQNLLPSSSTICQ*

MIP14606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17838-PA 213 GF17838-PA 4..213 3..217 878 76.9 Plus
Dana\GF17383-PA 251 GF17383-PA 24..208 38..200 218 31.9 Plus
Dana\GF16248-PA 226 GF16248-PA 43..224 38..211 172 29 Plus
Dana\GF16249-PA 207 GF16249-PA 29..186 38..190 159 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17351-PA 209 GG17351-PA 21..209 27..217 943 93.2 Plus
Dere\GG17054-PA 250 GG17054-PA 24..208 38..200 225 34.6 Plus
Dere\GG11212-PA 218 GG11212-PA 33..218 38..215 173 30 Plus
Dere\GG11213-PA 207 GG11213-PA 29..198 38..206 171 27.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19011-PA 208 GH19011-PA 20..208 27..217 732 70.2 Plus
Dgri\GH18545-PA 245 GH18545-PA 20..204 38..200 218 33.5 Plus
Dgri\GH14296-PA 193 GH14296-PA 16..179 38..200 162 28.7 Plus
Dgri\GH18523-PA 204 GH18523-PA 18..195 35..206 148 27.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9427-PB 212 CG9427-PB 1..212 6..217 1119 100 Plus
CG9427-PA 213 CG9427-PA 23..213 27..217 956 95.3 Plus
GILT1-PA 250 CG9796-PA 27..208 41..200 208 33.5 Plus
CG41378-PC 196 CG41378-PC 16..181 41..200 191 31.4 Plus
CG41378-PD 205 CG41378-PD 25..190 41..200 191 31.4 Plus
CG41378-PB 228 CG41378-PB 48..213 41..200 191 31.4 Plus
GILT3-PA 216 CG13822-PA 30..215 38..215 162 28.4 Plus
GILT2-PA 207 CG10157-PA 29..198 38..206 157 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23067-PA 208 GI23067-PA 7..208 14..217 731 66.2 Plus
Dmoj\GI23244-PA 245 GI23244-PA 20..204 38..200 221 32.4 Plus
Dmoj\GI23191-PA 206 GI23191-PA 29..192 38..200 176 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22172-PA 217 GL22172-PA 10..217 3..217 826 73.5 Plus
Dper\GL23064-PA 250 GL23064-PA 24..208 38..200 223 34.1 Plus
Dper\GL13648-PA 224 GL13648-PA 28..209 35..200 180 29.2 Plus
Dper\GL13649-PA 210 GL13649-PA 32..195 38..200 156 26.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21779-PA 217 GA21779-PA 12..217 1..217 827 72.4 Plus
Dpse\GA24052-PA 250 GA24052-PA 24..208 38..200 223 34.1 Plus
Dpse\GA22042-PA 250 GA22042-PA 24..208 38..200 223 34.1 Plus
Dpse\GA12550-PA 214 GA12550-PA 28..199 35..200 186 30.5 Plus
Dpse\GA10118-PA 210 GA10118-PA 32..195 38..200 156 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26237-PA 213 GM26237-PA 23..213 27..217 959 94.2 Plus
Dsec\GM25939-PA 250 GM25939-PA 24..208 38..200 226 34.6 Plus
Dsec\GM26511-PA 216 GM26511-PA 30..215 38..215 169 29.5 Plus
Dsec\GM26512-PA 208 GM26512-PA 30..199 38..206 160 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20778-PA 213 GD20778-PA 23..213 27..217 959 94.2 Plus
Dsim\GD20500-PA 250 GD20500-PA 24..208 38..200 219 34.1 Plus
Dsim\GD21021-PA 208 GD21021-PA 30..199 38..206 163 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24579-PA 209 GJ24579-PA 27..209 33..217 707 69.7 Plus
Dvir\GJ10741-PA 244 GJ10741-PA 20..204 38..200 224 33.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11854-PA 217 GK11854-PA 27..217 31..217 735 71.7 Plus
Dwil\GK13347-PA 232 GK13347-PA 23..207 38..200 224 33.5 Plus
Dwil\GK13875-PA 209 GK13875-PA 28..195 34..200 176 26.9 Plus
Dwil\GK13874-PA 223 GK13874-PA 39..207 38..200 148 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24757-PA 213 GE24757-PA 23..213 27..217 953 93.7 Plus
Dyak\GE24442-PA 250 GE24442-PA 24..208 38..200 222 34.1 Plus
Dyak\GE10377-PA 207 GE10377-PA 29..198 38..206 171 27.7 Plus

MIP14606.hyp Sequence

Translation from 0 to 653

> MIP14606.hyp
IILSFMLSLLIWQTFTYYSVLENICQEIKEQLKLNMKQLHITLLYESLCP
DSRNFMHQLGPVYEEFGDYIDILLVPFGKSQSERNGAIFHCQHGPAECKG
NRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCL
SSETGTKLQLQAELVTKQYSPSFIPTIVYNGVFDQQLQDHSLRDFRGTVC
YMLRQQNLLPSSSTICQ*

MIP14606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9427-PB 212 CG9427-PB 1..212 6..217 1119 100 Plus
CG9427-PA 213 CG9427-PA 23..213 27..217 956 95.3 Plus
GILT1-PA 250 CG9796-PA 27..208 41..200 208 33.5 Plus
CG41378-PC 196 CG41378-PC 16..181 41..200 191 31.4 Plus
CG41378-PD 205 CG41378-PD 25..190 41..200 191 31.4 Plus