Clone MIP14645 Report

Search the DGRC for MIP14645

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:146
Well:45
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptBet5-RA
Protein status:MIP14645.pep: gold
Sequenced Size:1071

Clone Sequence Records

MIP14645.complete Sequence

1071 bp assembled on 2009-11-12

GenBank Submission: BT100282.1

> MIP14645.complete
GAGGTTGGCAGCACCTTTCGAATGTTTTTGTTTTGCATCGGAAATTGAAG
TAATTTGCATTCCATAACTTCGCCAGAAATAACTCCCTTTCAAGGCTAAT
GCCATTCCAAATAGCCTTAGCAAGATGACCATCTTTAACCTGTACATATT
CGACAAGTTCGGAACACTGCTCCACTACGCAGAATGGAATCGCACCAAGA
AATCGGGCATCACACGCGAGGAAGAAGCCAAACTCACCTACGGAATGCTC
TTCTCCATAAAGTCCTTCGTCAGTAAGATATCGCCACACGATCCCAAGGA
GGGCTTCCTTTACTACAAGACCAATCGCTACGCCCTGCATTATCTGGAAA
CTCCCTCTGGATTAAAGTTCGTTCTCAACACGGACACGACGGCCATCAAT
GTGAAGGAGCTGCTACAGCAGTTGTACGCCAAGGTGTGGGTAGAGTTCGT
CGTGCGAGATCCACTGTGGACACCCGGCACGGTGGTCACCTCGGAGCTGT
TCCAGTCCAAGCTCGATGAGTTCGTCAGGCAGTCACCCATCTTCGGCATT
CGCAATATATAAACAAATAAATAGCTTAAGCTCAAACTACTATTAGGTAT
GCTAGGTATGCAAATCCCGCCTTCGAAACTCTAAGGTCTATGTCATTAGC
TCCGAATGGCAAATTGCGCTGGCAAGTGCTCCGAAATGCAGCGCGCGAGA
TCCGGGCTCCGGAAATGGCATGCACTTAAAATGTCTGCGGGGCCAGCGAG
AAAAACAGGCCCCATGGTTGCGCAAGTCGTCCACTGTCTACTGTCCAATG
GCCACTGCTAACAAAGGGGGACAAATGTCAAAGCGGTTGCCGCAACTCGA
AGGTTTTAGTCAACTCCACAAGCTGAGAAAATTACTGACTGACTGTCTGC
TGCAGGCGAGCAGGGACTACACGGATAAAAATGATATGATTAATACTAAT
TGCACTAGGAGTCCACTGTCATCGAATTGCACTTGAAAAGCAAATCACAT
TGCCTGAGAAATAATATTATTAACACATATGTATAAAGCTGTTAAAACTT
TAAAAAAAAAAAAAAAAAAAA

MIP14645.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5.b 1132 Bet5.b 11..1062 1..1052 5260 100 Plus
Bet5-RA 738 Bet5-RA 11..738 1..728 3640 100 Plus
Bet5.a 657 Bet5.a 1..588 9..596 2940 100 Plus
Bet5.a 657 Bet5.a 584..657 645..718 370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26003263..26003947 367..1051 3395 99.7 Plus
chr3R 27901430 chr3R 26002693..26002916 1..224 1075 98.7 Plus
chr3R 27901430 chr3R 26002970..26003114 224..368 710 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30180802..30181487 367..1052 3430 100 Plus
3R 32079331 3R 30180232..30180455 1..224 1120 100 Plus
3R 32079331 3R 30180509..30180653 224..368 725 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29921633..29922318 367..1052 3430 100 Plus
3R 31820162 3R 29921063..29921286 1..224 1120 100 Plus
3R 31820162 3R 29921340..29921484 224..368 725 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:38:43 has no hits.

MIP14645.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:39:53 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26002693..26002915 1..223 98 -> Plus
chr3R 26002970..26003112 224..366 99 -> Plus
chr3R 26003263..26003947 367..1051 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-12 10:59:34 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
CG1359-RA 1..438 125..562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:55 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..438 125..562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:11 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..438 125..562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:51 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..438 125..562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-12 10:59:33 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
CG1359-RA 1..536 51..586 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:55 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..536 51..586 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:11 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..1051 1..1051 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:51 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
Bet5-RA 1..1051 1..1051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:53 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30180232..30180454 1..223 100 -> Plus
3R 30180509..30180651 224..366 100 -> Plus
3R 30180802..30181486 367..1051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:53 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30180232..30180454 1..223 100 -> Plus
3R 30180509..30180651 224..366 100 -> Plus
3R 30180802..30181486 367..1051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:53 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30180232..30180454 1..223 100 -> Plus
3R 30180509..30180651 224..366 100 -> Plus
3R 30180802..30181486 367..1051 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:11 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26005954..26006176 1..223 100 -> Plus
arm_3R 26006231..26006373 224..366 100 -> Plus
arm_3R 26006524..26007208 367..1051 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:16 Download gff for MIP14645.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29921340..29921482 224..366 100 -> Plus
3R 29921063..29921285 1..223 100 -> Plus
3R 29921633..29922317 367..1051 100   Plus

MIP14645.hyp Sequence

Translation from 124 to 561

> MIP14645.hyp
MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVS
KISPHDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQL
YAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFVRQSPIFGIRNI*

MIP14645.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5-PA 145 CG1359-PA 1..145 1..145 760 100 Plus

MIP14645.pep Sequence

Translation from 124 to 561

> MIP14645.pep
MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVS
KISPHDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQL
YAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFVRQSPIFGIRNI*

MIP14645.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18826-PA 145 GF18826-PA 1..145 1..145 744 95.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11737-PA 145 GG11737-PA 1..145 1..145 765 100 Plus
Dere\GG25299-PA 219 GG25299-PA 114..217 41..145 135 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19150-PA 145 GH19150-PA 1..145 1..145 743 95.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Bet5-PA 145 CG1359-PA 1..145 1..145 760 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23258-PA 145 GI23258-PA 1..145 1..145 746 95.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13448-PA 145 GL13448-PA 1..145 1..145 732 93.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12383-PA 145 GA12383-PA 1..145 1..145 732 93.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12867-PA 145 GM12867-PA 1..145 1..145 758 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Anp-PA 61 GD21507-PA 1..34 1..34 184 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10754-PA 145 GJ10754-PA 1..145 1..145 744 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14119-PA 145 GK14119-PA 1..145 1..145 725 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10864-PA 145 GE10864-PA 1..145 1..145 765 100 Plus