BDGP Sequence Production Resources |
Search the DGRC for MIP14645
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 146 |
Well: | 45 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | Bet5-RA |
Protein status: | MIP14645.pep: gold |
Sequenced Size: | 1071 |
1071 bp assembled on 2009-11-12
GenBank Submission: BT100282.1
> MIP14645.complete GAGGTTGGCAGCACCTTTCGAATGTTTTTGTTTTGCATCGGAAATTGAAG TAATTTGCATTCCATAACTTCGCCAGAAATAACTCCCTTTCAAGGCTAAT GCCATTCCAAATAGCCTTAGCAAGATGACCATCTTTAACCTGTACATATT CGACAAGTTCGGAACACTGCTCCACTACGCAGAATGGAATCGCACCAAGA AATCGGGCATCACACGCGAGGAAGAAGCCAAACTCACCTACGGAATGCTC TTCTCCATAAAGTCCTTCGTCAGTAAGATATCGCCACACGATCCCAAGGA GGGCTTCCTTTACTACAAGACCAATCGCTACGCCCTGCATTATCTGGAAA CTCCCTCTGGATTAAAGTTCGTTCTCAACACGGACACGACGGCCATCAAT GTGAAGGAGCTGCTACAGCAGTTGTACGCCAAGGTGTGGGTAGAGTTCGT CGTGCGAGATCCACTGTGGACACCCGGCACGGTGGTCACCTCGGAGCTGT TCCAGTCCAAGCTCGATGAGTTCGTCAGGCAGTCACCCATCTTCGGCATT CGCAATATATAAACAAATAAATAGCTTAAGCTCAAACTACTATTAGGTAT GCTAGGTATGCAAATCCCGCCTTCGAAACTCTAAGGTCTATGTCATTAGC TCCGAATGGCAAATTGCGCTGGCAAGTGCTCCGAAATGCAGCGCGCGAGA TCCGGGCTCCGGAAATGGCATGCACTTAAAATGTCTGCGGGGCCAGCGAG AAAAACAGGCCCCATGGTTGCGCAAGTCGTCCACTGTCTACTGTCCAATG GCCACTGCTAACAAAGGGGGACAAATGTCAAAGCGGTTGCCGCAACTCGA AGGTTTTAGTCAACTCCACAAGCTGAGAAAATTACTGACTGACTGTCTGC TGCAGGCGAGCAGGGACTACACGGATAAAAATGATATGATTAATACTAAT TGCACTAGGAGTCCACTGTCATCGAATTGCACTTGAAAAGCAAATCACAT TGCCTGAGAAATAATATTATTAACACATATGTATAAAGCTGTTAAAACTT TAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bet5.b | 1132 | Bet5.b | 11..1062 | 1..1052 | 5260 | 100 | Plus |
Bet5-RA | 738 | Bet5-RA | 11..738 | 1..728 | 3640 | 100 | Plus |
Bet5.a | 657 | Bet5.a | 1..588 | 9..596 | 2940 | 100 | Plus |
Bet5.a | 657 | Bet5.a | 584..657 | 645..718 | 370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26003263..26003947 | 367..1051 | 3395 | 99.7 | Plus |
chr3R | 27901430 | chr3R | 26002693..26002916 | 1..224 | 1075 | 98.7 | Plus |
chr3R | 27901430 | chr3R | 26002970..26003114 | 224..368 | 710 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30180802..30181487 | 367..1052 | 3430 | 100 | Plus |
3R | 32079331 | 3R | 30180232..30180455 | 1..224 | 1120 | 100 | Plus |
3R | 32079331 | 3R | 30180509..30180653 | 224..368 | 725 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29921633..29922318 | 367..1052 | 3430 | 100 | Plus |
3R | 31820162 | 3R | 29921063..29921286 | 1..224 | 1120 | 100 | Plus |
3R | 31820162 | 3R | 29921340..29921484 | 224..368 | 725 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26002693..26002915 | 1..223 | 98 | -> | Plus |
chr3R | 26002970..26003112 | 224..366 | 99 | -> | Plus |
chr3R | 26003263..26003947 | 367..1051 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1359-RA | 1..438 | 125..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..438 | 125..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..438 | 125..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..438 | 125..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1359-RA | 1..536 | 51..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..536 | 51..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..1051 | 1..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bet5-RA | 1..1051 | 1..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30180232..30180454 | 1..223 | 100 | -> | Plus |
3R | 30180509..30180651 | 224..366 | 100 | -> | Plus |
3R | 30180802..30181486 | 367..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30180232..30180454 | 1..223 | 100 | -> | Plus |
3R | 30180509..30180651 | 224..366 | 100 | -> | Plus |
3R | 30180802..30181486 | 367..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30180232..30180454 | 1..223 | 100 | -> | Plus |
3R | 30180509..30180651 | 224..366 | 100 | -> | Plus |
3R | 30180802..30181486 | 367..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26005954..26006176 | 1..223 | 100 | -> | Plus |
arm_3R | 26006231..26006373 | 224..366 | 100 | -> | Plus |
arm_3R | 26006524..26007208 | 367..1051 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29921340..29921482 | 224..366 | 100 | -> | Plus |
3R | 29921063..29921285 | 1..223 | 100 | -> | Plus |
3R | 29921633..29922317 | 367..1051 | 100 | Plus |
Translation from 124 to 561
> MIP14645.hyp MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVS KISPHDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQL YAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFVRQSPIFGIRNI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bet5-PA | 145 | CG1359-PA | 1..145 | 1..145 | 760 | 100 | Plus |
Translation from 124 to 561
> MIP14645.pep MTIFNLYIFDKFGTLLHYAEWNRTKKSGITREEEAKLTYGMLFSIKSFVS KISPHDPKEGFLYYKTNRYALHYLETPSGLKFVLNTDTTAINVKELLQQL YAKVWVEFVVRDPLWTPGTVVTSELFQSKLDEFVRQSPIFGIRNI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18826-PA | 145 | GF18826-PA | 1..145 | 1..145 | 744 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11737-PA | 145 | GG11737-PA | 1..145 | 1..145 | 765 | 100 | Plus |
Dere\GG25299-PA | 219 | GG25299-PA | 114..217 | 41..145 | 135 | 27.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19150-PA | 145 | GH19150-PA | 1..145 | 1..145 | 743 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bet5-PA | 145 | CG1359-PA | 1..145 | 1..145 | 760 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23258-PA | 145 | GI23258-PA | 1..145 | 1..145 | 746 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13448-PA | 145 | GL13448-PA | 1..145 | 1..145 | 732 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12383-PA | 145 | GA12383-PA | 1..145 | 1..145 | 732 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12867-PA | 145 | GM12867-PA | 1..145 | 1..145 | 758 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Anp-PA | 61 | GD21507-PA | 1..34 | 1..34 | 184 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10754-PA | 145 | GJ10754-PA | 1..145 | 1..145 | 744 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14119-PA | 145 | GK14119-PA | 1..145 | 1..145 | 725 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10864-PA | 145 | GE10864-PA | 1..145 | 1..145 | 765 | 100 | Plus |