Clone MIP14971 Report

Search the DGRC for MIP14971

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:149
Well:71
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34191-RA
Protein status:MIP14971.pep: gold
Sequenced Size:603

Clone Sequence Records

MIP14971.complete Sequence

603 bp assembled on 2009-11-09

GenBank Submission: BT100274.1

> MIP14971.complete
CACTAGCAAATATATTACTTAAAATTTAAGAGAAAAATTAATAAAGTTCT
ATACATGTATTCCTAATTAGGTACGGACATAGGTACATTTATGCAAATAT
TACTCATCACAGACGATAACTCGCTGCCTTGCCTATCGTAATATTGACCG
CACTAAAGGCTCAAACACTCTGCCTGTGGAAAACATCGGAAACCCGTTTA
TTCCCATAGAGTATCAAAACTGACCACGTCTGCACATTCCACTATGAGCA
AAGTAACCTTCAAAATCACGCTAACTTCGGACCCCAAGCTGCCCTTTAAG
GTGCTTAGTGTTCCGGAGGGAACTCCCTTTACGGCTGTGCTGAAATTCGC
CTCTGAAGAGTTCAAGGTTCCGGCGGAGACGAGTGCCATCATCACGGACG
ATGGAATTGGCATCAGCCCACAGCAGACTGCTGGTAATGTGTTCCTAAAG
CACGGATCCGAGCTGCGCCTCATACCCAGAGATCGAGTGGGCCACCAACT
AAGCTAGTTTTCTTAATCCCATCTTATTTACCCTTTGAGATTTTCCCCCT
TTTTGATGCTTATTAAATGTTAAACAATGTATCCGAAAAAAAAAAAAAAA
AAA

MIP14971.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191.a 609 CG34191.a 70..585 71..586 2565 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12839346..12839773 158..585 2140 100 Plus
chr2R 21145070 chr2R 12839091..12839248 1..158 790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:18:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16952152..16952580 158..586 2130 99.8 Plus
2R 25286936 2R 16951897..16952054 1..158 760 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16953351..16953779 158..586 2130 99.7 Plus
2R 25260384 2R 16953096..16953253 1..158 760 98.7 Plus
Blast to na_te.dros performed 2019-03-16 05:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2543..2575 12..44 120 84.8 Plus

MIP14971.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:03:08 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12839091..12839247 1..157 100 -> Plus
chr2R 12839346..12839773 158..585 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-09 16:33:34 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 244..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:18:16 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 244..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 1..264 244..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:54:00 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 1..264 244..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-09 16:33:34 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..264 244..507 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:18:16 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 1..477 109..585 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 61..645 1..585 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:54:00 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 61..645 1..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16951897..16952053 1..157 98 -> Plus
2R 16952152..16952579 158..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16951897..16952053 1..157 98 -> Plus
2R 16952152..16952579 158..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16951897..16952053 1..157 98 -> Plus
2R 16952152..16952579 158..585 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:33 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12839402..12839558 1..157 98 -> Plus
arm_2R 12839657..12840084 158..585 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:31 Download gff for MIP14971.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16953351..16953778 158..585 99   Plus
2R 16953096..16953252 1..157 98 -> Plus

MIP14971.hyp Sequence

Translation from 243 to 506

> MIP14971.hyp
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*

MIP14971.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-PA 87 CG34191-PA 1..87 1..87 438 100 Plus
CG34191-PB 87 CG34191-PB 1..87 1..87 438 100 Plus

MIP14971.pep Sequence

Translation from 243 to 506

> MIP14971.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*

MIP14971.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22653-PA 84 GH22653-PA 1..84 1..84 417 97.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ufm1-PA 87 CG34191-PA 1..87 1..87 438 100 Plus
Ufm1-PB 87 CG34191-PB 1..87 1..87 438 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21165-PA 84 GI21165-PA 1..84 1..84 424 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11573-PA 84 GL11573-PA 1..84 1..84 429 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24773-PA 84 GA24773-PA 1..84 1..84 429 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21018-PA 84 GJ21018-PA 1..84 1..84 424 98.8 Plus