MIP14971.complete Sequence
603 bp assembled on 2009-11-09
GenBank Submission: BT100274.1
> MIP14971.complete
CACTAGCAAATATATTACTTAAAATTTAAGAGAAAAATTAATAAAGTTCT
ATACATGTATTCCTAATTAGGTACGGACATAGGTACATTTATGCAAATAT
TACTCATCACAGACGATAACTCGCTGCCTTGCCTATCGTAATATTGACCG
CACTAAAGGCTCAAACACTCTGCCTGTGGAAAACATCGGAAACCCGTTTA
TTCCCATAGAGTATCAAAACTGACCACGTCTGCACATTCCACTATGAGCA
AAGTAACCTTCAAAATCACGCTAACTTCGGACCCCAAGCTGCCCTTTAAG
GTGCTTAGTGTTCCGGAGGGAACTCCCTTTACGGCTGTGCTGAAATTCGC
CTCTGAAGAGTTCAAGGTTCCGGCGGAGACGAGTGCCATCATCACGGACG
ATGGAATTGGCATCAGCCCACAGCAGACTGCTGGTAATGTGTTCCTAAAG
CACGGATCCGAGCTGCGCCTCATACCCAGAGATCGAGTGGGCCACCAACT
AAGCTAGTTTTCTTAATCCCATCTTATTTACCCTTTGAGATTTTCCCCCT
TTTTGATGCTTATTAAATGTTAAACAATGTATCCGAAAAAAAAAAAAAAA
AAA
MIP14971.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:42:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191.a | 609 | CG34191.a | 70..585 | 71..586 | 2565 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:02:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 12839346..12839773 | 158..585 | 2140 | 100 | Plus |
chr2R | 21145070 | chr2R | 12839091..12839248 | 1..158 | 790 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:18:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16952152..16952580 | 158..586 | 2130 | 99.8 | Plus |
2R | 25286936 | 2R | 16951897..16952054 | 1..158 | 760 | 98.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 16953351..16953779 | 158..586 | 2130 | 99.7 | Plus |
2R | 25260384 | 2R | 16953096..16953253 | 1..158 | 760 | 98.7 | Plus |
Blast to na_te.dros performed 2019-03-16 05:02:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbif\P-element_M | 2935 | Dbif\P-element_M P_M 2935bp Derived from X60990. | 2543..2575 | 12..44 | 120 | 84.8 | Plus |
MIP14971.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:03:08 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 12839091..12839247 | 1..157 | 100 | -> | Plus |
chr2R | 12839346..12839773 | 158..585 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-09 16:33:34 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 244..507 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:18:16 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 244..507 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 1..264 | 244..507 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:54:00 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 1..264 | 244..507 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-09 16:33:34 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..264 | 244..507 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:18:16 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 1..477 | 109..585 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:33 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 61..645 | 1..585 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:54:00 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 61..645 | 1..585 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16951897..16952053 | 1..157 | 98 | -> | Plus |
2R | 16952152..16952579 | 158..585 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16951897..16952053 | 1..157 | 98 | -> | Plus |
2R | 16952152..16952579 | 158..585 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:08 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16951897..16952053 | 1..157 | 98 | -> | Plus |
2R | 16952152..16952579 | 158..585 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:33 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12839402..12839558 | 1..157 | 98 | -> | Plus |
arm_2R | 12839657..12840084 | 158..585 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:31 Download gff for
MIP14971.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16953351..16953778 | 158..585 | 99 | | Plus |
2R | 16953096..16953252 | 1..157 | 98 | -> | Plus |
MIP14971.hyp Sequence
Translation from 243 to 506
> MIP14971.hyp
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*
MIP14971.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-PA | 87 | CG34191-PA | 1..87 | 1..87 | 438 | 100 | Plus |
CG34191-PB | 87 | CG34191-PB | 1..87 | 1..87 | 438 | 100 | Plus |
MIP14971.pep Sequence
Translation from 243 to 506
> MIP14971.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*
MIP14971.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:55:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH22653-PA | 84 | GH22653-PA | 1..84 | 1..84 | 417 | 97.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ufm1-PA | 87 | CG34191-PA | 1..87 | 1..87 | 438 | 100 | Plus |
Ufm1-PB | 87 | CG34191-PB | 1..87 | 1..87 | 438 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:55:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21165-PA | 84 | GI21165-PA | 1..84 | 1..84 | 424 | 98.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:55:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11573-PA | 84 | GL11573-PA | 1..84 | 1..84 | 429 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:55:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24773-PA | 84 | GA24773-PA | 1..84 | 1..84 | 429 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:55:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21018-PA | 84 | GJ21018-PA | 1..84 | 1..84 | 424 | 98.8 | Plus |