Clone MIP15642 Report

Search the DGRC for MIP15642

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:156
Well:42
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG12963-RF
Protein status:MIP15642.pep: gold
Sequenced Size:1154

Clone Sequence Records

MIP15642.complete Sequence

1154 bp assembled on 2010-01-04

GenBank Submission: BT120095.1

> MIP15642.complete
TTGTTTGGATCTTGAAATGCTGGTGTTATAGACATCGAAACCATCGAATA
GATTCTCGTAAGTTACACTGGCTTTGGTTTGTGTGTGCAAACCGCCGGAC
CGTATATATGGTATATCTGATATATGGAGTAACATTTATGGGGTAATGCC
AACCAAACATGGCGGACAATCTAATCTTGGGCGACTAATCAATTGCGTGC
TGAACGGCGAACTATGGGTAATACTAGTGTCTACAAAACGCAGTTGGTGG
CTGTAGTTCGGCATTGATTCCTGCTCCGCGTCGTTCTAAGTCTCATCATG
CACGGATCGGAGCCGACATTGGATTGGGGCAGCGGCTTCGGCCTGCACAT
AGCCATCTATTTGGCCCTGGTGTTCTTCTTTTTCTGCGTACTACCGCTGG
CCTGCTACTACATCCGCGTAGAGAGCCAAACTCTGGCAAAGATCTGCCAG
CCGCGATGTCGACGTCAGCAGAGGATTCCAGAGCACCATCGTCAGCGATA
CGGCATTGAAATTGATCGTAATGTATTCAACGCACAGGAGGATCCTTCAT
CGAACCGCTATGGCGACATTTTCTTCATCGAACCCGGCAGCGTGGAGGCC
AACCGCATTCGCGATCAACTGGAAAAGGATGAAAAGGATTTACCCAGCTA
CGACGAGGTGATGCGCATGTGTAACCTGACCACTCCCACAGCAGCAGCGG
CTGGAATGCCTGTTCCCCAATCGCCCCTCGGTGTACCCAGTCCCATTGGA
ATCGCGGCACTGCCGGCGCCACCGTATTCGGAGACAGATCCACATTCCTC
GTCCGCCGCAGAAGCCACTGTCATCGCAATGGAACCGATGGAGCCATCCA
CCTCCCGCGCGGCACAGATTCCACCCAGCTCCGGATCTGGTCCTCCTGCT
CCATTGCCAACGACAGCGGTGTGATCCGTCGGAGGCATGGATAAATTGGA
ACTGAAGCATTCGCCGTGCCACTCTGGGCCACACAGATGCCACTTTGTGT
GCGCTTTCAGTACAGAAATGAACTTGTGTGATCTTATTGAGTACATACCT
ATTTAAGTTCTAGACATTAGGAGTCGCATATTGTAAATATATATTTTTAG
GACATAGGATGAAAATTAAAGTGAATTATTTAATTGAAAAAAAAAAAAAA
AAAA

MIP15642.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963.j 1478 CG12963.j 733..1360 513..1140 3140 100 Plus
CG12963.l 1388 CG12963.l 643..1270 513..1140 3140 100 Plus
CG12963.h 1741 CG12963.h 1119..1741 514..1136 3115 100 Plus
CG12963.j 1478 CG12963.j 1..512 3..514 2560 100 Plus
CG12963.h 1741 CG12963.h 1..500 15..514 2500 100 Plus
CG12963.l 1388 CG12963.l 1..422 93..514 2110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11448966..11449588 514..1136 3115 100 Plus
chr2R 21145070 chr2R 11447752..11448265 1..514 2555 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:19:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15561814..15562440 514..1140 3135 100 Plus
2R 25286936 2R 15560600..15561113 1..514 2570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15563013..15563639 514..1140 3135 100 Plus
2R 25260384 2R 15561799..15562312 1..514 2570 100 Plus
Blast to na_te.dros performed 2019-03-16 07:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3427..3468 628..587 111 73.8 Minus

MIP15642.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:58:35 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11447752..11448265 1..514 99 -> Plus
chr2R 11448967..11449588 515..1136 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-04 10:47:17 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RD 137..561 500..924 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:52 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 197..612 508..924 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:53 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RF 1..627 298..924 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:47 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RF 1..627 298..924 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-04 10:47:16 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RD 137..773 500..1136 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:52 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 205..832 508..1136 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:53 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RF 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:47 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RF 1..1136 1..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:35 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15560600..15561113 1..514 100 -> Plus
2R 15561815..15562436 515..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:35 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15560600..15561113 1..514 100 -> Plus
2R 15561815..15562436 515..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:35 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15560600..15561113 1..514 100 -> Plus
2R 15561815..15562436 515..1136 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:53 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11448105..11448618 1..514 100 -> Plus
arm_2R 11449320..11449941 515..1136 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:20 Download gff for MIP15642.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15561799..15562312 1..514 100 -> Plus
2R 15563014..15563635 515..1136 100   Plus

MIP15642.pep Sequence

Translation from 297 to 923

> MIP15642.pep
MHGSEPTLDWGSGFGLHIAIYLALVFFFFCVLPLACYYIRVESQTLAKIC
QPRCRRQQRIPEHHRQRYGIEIDRNVFNAQEDPSSNRYGDIFFIEPGSVE
ANRIRDQLEKDEKDLPSYDEVMRMCNLTTPTAAAAGMPVPQSPLGVPSPI
GIAALPAPPYSETDPHSSSAAEATVIAMEPMEPSTSRAAQIPPSSGSGPP
APLPTTAV*

MIP15642.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11144-PA 191 GF11144-PA 1..173 22..191 443 58.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20536-PA 307 GG20536-PA 84..307 1..208 901 83.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19971-PA 172 GH19971-PA 6..164 10..188 255 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PF 208 CG12963-PF 1..208 1..208 1103 100 Plus
CG12963-PH 197 CG12963-PH 7..197 21..208 740 77.5 Plus
CG12963-PA 190 CG12963-PA 1..190 20..208 719 77 Plus
CG12963-PJ 179 CG12963-PJ 2..179 13..208 718 75 Plus
CG12963-PC 178 CG12963-PC 37..178 67..208 712 97.2 Plus
CG12963-PN 180 CG12963-PN 8..180 21..208 710 77 Plus
CG12963-PE 203 CG12963-PE 30..203 24..208 709 79.5 Plus
CG12963-PM 176 CG12963-PM 8..176 21..208 708 77.1 Plus
CG12963-PG 213 CG12963-PG 75..213 70..208 707 97.8 Plus
CG12963-PL 169 CG12963-PL 34..169 73..208 706 100 Plus
CG12963-PI 179 CG12963-PI 34..179 63..208 706 93.2 Plus
CG12963-PD 186 CG12963-PD 51..186 73..208 706 100 Plus
CG12963-PK 200 CG12963-PK 65..200 73..208 706 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20257-PA 258 GI20257-PA 130..256 67..191 286 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20080-PA 201 GL20080-PA 61..196 77..207 368 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11943-PD 219 GA11943-PD 4..214 6..207 564 62.8 Plus
Dpse\GA11943-PE 190 GA11943-PE 6..185 20..207 403 52.3 Plus
Dpse\GA11943-PB 197 GA11943-PB 6..192 12..207 396 51.2 Plus
Dpse\GA11943-PF 193 GA11943-PF 6..188 17..207 394 52 Plus
Dpse\GA11943-PK 214 GA11943-PK 5..209 8..207 392 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21627-PA 190 GM21627-PA 1..190 20..208 666 74.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11129-PA 190 GD11129-PA 1..190 20..208 679 75.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20211-PA 171 GJ20211-PA 5..170 27..192 342 50.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23031-PA 206 GK23031-PA 9..192 15..197 336 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11720-PA 424 GE11720-PA 210..424 1..208 892 87 Plus

MIP15642.hyp Sequence

Translation from 297 to 923

> MIP15642.hyp
MHGSEPTLDWGSGFGLHIAIYLALVFFFFCVLPLACYYIRVESQTLAKIC
QPRCRRQQRIPEHHRQRYGIEIDRNVFNAQEDPSSNRYGDIFFIEPGSVE
ANRIRDQLEKDEKDLPSYDEVMRMCNLTTPTAAAAGMPVPQSPLGVPSPI
GIAALPAPPYSETDPHSSSAAEATVIAMEPMEPSTSRAAQIPPSSGSGPP
APLPTTAV*

MIP15642.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PF 208 CG12963-PF 1..208 1..208 1103 100 Plus
CG12963-PH 197 CG12963-PH 7..197 21..208 740 77.5 Plus
CG12963-PA 190 CG12963-PA 1..190 20..208 719 77 Plus
CG12963-PJ 179 CG12963-PJ 2..179 13..208 718 75 Plus
CG12963-PC 178 CG12963-PC 37..178 67..208 712 97.2 Plus