Clone MIP15662 Report

Search the DGRC for MIP15662

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:156
Well:62
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14207-RC
Protein status:MIP15662.pep: gold
Sequenced Size:750

Clone Sequence Records

MIP15662.complete Sequence

750 bp assembled on 2010-01-04

GenBank Submission: BT120097.1

> MIP15662.complete
AGCATGGAGGCCTTTACGCGCACACTGCAAAATACCTTTCGCAGCACTAG
GACCACCAGAACCACTACTACAACAACCACAAACTCCTCCACCAGCTCAA
CGACAAACTCGGCGCTGCCATCCCGAATCCCAAAGCAACAGAACTACGTC
TCCGACATTAGCTCACCCTTGATCCAGGATGAGGGCGATAACAAAGTGCT
GAAGCTGCGTTTCGATGTCAGCCAGTATGCGCCCGAGGAAATTGTTGTGA
AAACCGTCGACCAGAAGCTATTGGTGCACGCCAAGCACGAGGAGAAGTCG
GACACAAAGAGCGTGTACAGGGAGTACAATCGGGAGTTCCTGCTGCCCAA
GGGCGTCAATCCCGAGTCCATCCGCTCGTCCCTCAGCAAGGACGGAGTCC
TGACCGTGGACGCCCCCCTGCCAGCACTCACCGCCGGCGAGACACTGATT
CCCATTGCGCACAAGTGAAGGCCAGCCCAGTTGTCCAGTTGTCCAGCTAT
CCAGTCACCATGGTCCCAAGCCGGTTGAGGAGCAATAGGCGCAGGAGGAG
CAGGAGGAGTGCGAGCTGCTGCCGATCAGATTAAATCCATACACACATTG
AGTTTAATCCAATCCTATCTAAATGATTAATTTTTTTGGTTCTGACTTAA
AGCTAAACTATGTTACTGACGTACTACTCATTAACTTAAATATAATTGAA
ATTATTATTAAATTTGATTAATTTAATTCATAAAAAAAAAAAAAAAAAAA

MIP15662.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207.a 1025 CG14207.a 68..799 1..732 3660 100 Plus
CG14207-RA 1504 CG14207-RA 569..1213 88..732 3225 100 Plus
CG14207-RB 1480 CG14207-RB 548..1189 91..732 3210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19499487..19499945 273..731 2295 100 Plus
chrX 22417052 chrX 19499317..19499417 175..275 505 100 Plus
chrX 22417052 chrX 19498952..19499046 1..95 475 100 Plus
chrX 22417052 chrX 19499170..19499255 93..178 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:19:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19610695..19611154 273..732 2300 100 Plus
X 23542271 X 19610525..19610625 175..275 505 100 Plus
X 23542271 X 19610160..19610254 1..95 475 100 Plus
X 23542271 X 19610378..19610463 93..178 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19618793..19619252 273..732 2300 100 Plus
X 23527363 X 19618623..19618723 175..275 505 100 Plus
X 23527363 X 19618258..19618352 1..95 475 100 Plus
X 23527363 X 19618476..19618561 93..178 430 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:17:08 has no hits.

MIP15662.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:18:01 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19498952..19499046 1..95 100 -> Plus
chrX 19499173..19499254 96..177 100 -> Plus
chrX 19499320..19499415 178..273 100 -> Plus
chrX 19499488..19499897 274..683 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-04 10:47:13 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 172..552 88..468 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:27:03 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
HspB8-RA 172..552 88..468 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:43:00 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 1..465 4..468 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:27 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 1..465 4..468 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-04 10:47:11 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 518..1161 88..731 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:27:02 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
HspB8-RA 518..1161 88..731 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:43:00 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 23..753 1..731 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:27 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 23..753 1..731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:01 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
X 19610160..19610254 1..95 100 -> Plus
X 19610381..19610462 96..177 100 -> Plus
X 19610528..19610623 178..273 100 -> Plus
X 19610696..19611153 274..731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:01 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
X 19610160..19610254 1..95 100 -> Plus
X 19610381..19610462 96..177 100 -> Plus
X 19610528..19610623 178..273 100 -> Plus
X 19610696..19611153 274..731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:01 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
X 19610160..19610254 1..95 100 -> Plus
X 19610381..19610462 96..177 100 -> Plus
X 19610528..19610623 178..273 100 -> Plus
X 19610696..19611153 274..731 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:43:00 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19504193..19504287 1..95 100 -> Plus
arm_X 19504414..19504495 96..177 100 -> Plus
arm_X 19504561..19504656 178..273 100 -> Plus
arm_X 19504729..19505186 274..731 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:27 Download gff for MIP15662.complete
Subject Subject Range Query Range Percent Splice Strand
X 19618794..19619251 274..731 100   Plus
X 19618258..19618352 1..95 100 -> Plus
X 19618479..19618560 96..177 100 -> Plus
X 19618626..19618721 178..273 100 -> Plus

MIP15662.pep Sequence

Translation from 0 to 467

> MIP15662.pep
SMEAFTRTLQNTFRSTRTTRTTTTTTTNSSTSSTTNSALPSRIPKQQNYV
SDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKS
DTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLI
PIAHK*

MIP15662.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20408-PA 193 GF20408-PA 74..193 36..155 636 100 Plus
Dana\GF11829-PA 187 GF11829-PA 75..156 63..143 192 45.1 Plus
Dana\GF23739-PA 205 GF23739-PA 65..161 45..141 167 35.7 Plus
Dana\GF10691-PA 190 GF10691-PA 71..146 67..141 161 42.1 Plus
Dana\GF10323-PA 155 GF10323-PA 48..136 52..144 152 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19234-PA 192 GG19234-PA 41..192 2..155 638 85.7 Plus
Dere\GG20009-PA 187 GG20009-PA 75..161 63..148 193 43.7 Plus
Dere\GG14046-PA 445 GG14046-PA 126..201 67..141 177 42.1 Plus
Dere\GG14047-PA 208 GG14047-PA 74..164 51..141 162 39.1 Plus
Dere\GG14448-PA 154 GG14448-PA 47..140 52..149 150 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24938-PA 193 GH24938-PA 74..193 36..155 629 98.3 Plus
Dgri\GH21555-PA 189 GH21555-PA 77..169 63..152 185 41.9 Plus
Dgri\GH14699-PA 605 GH14699-PA 204..274 67..136 173 42.3 Plus
Dgri\GH14558-PA 201 GH14558-PA 93..178 61..144 165 38.4 Plus
Dgri\GH14700-PA 204 GH14700-PA 31..157 17..141 164 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PC 154 CG14207-PC 1..154 2..155 771 100 Plus
CG14207-PB 192 CG14207-PB 54..192 11..155 650 91.7 Plus
CG14207-PD 183 CG14207-PD 58..183 30..155 631 100 Plus
CG14207-PA 183 CG14207-PA 58..183 30..155 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 63..148 194 43.7 Plus
l(2)efl-PA 187 CG4533-PA 75..161 63..148 194 43.7 Plus
Hsp27-PB 213 CG4466-PB 95..165 72..141 169 46.5 Plus
Hsp27-PA 213 CG4466-PA 95..165 72..141 169 46.5 Plus
Hsp67Ba-PA 445 CG4167-PA 128..202 68..141 169 42.7 Plus
CG4461-PA 200 CG4461-PA 94..189 63..152 161 36.5 Plus
Hsp26-PB 208 CG4183-PB 94..164 72..141 156 45.1 Plus
Hsp26-PA 208 CG4183-PA 94..164 72..141 156 45.1 Plus
Hsp23-PB 186 CG4463-PB 76..146 72..141 151 42.3 Plus
Hsp23-PA 186 CG4463-PA 76..146 72..141 151 42.3 Plus
Hsp67Bc-PA 199 CG4190-PA 82..171 68..154 139 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11114-PA 193 GI11114-PA 74..193 36..155 626 98.3 Plus
Dmoj\GI19527-PA 189 GI19527-PA 77..158 63..143 190 45.1 Plus
Dmoj\GI12245-PA 198 GI12245-PA 73..172 52..141 170 37 Plus
Dmoj\GI12246-PA 558 GI12246-PA 164..236 67..138 170 41.1 Plus
Dmoj\GI13089-PA 193 GI13089-PA 81..170 68..154 167 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27055-PA 193 GL27055-PA 74..193 36..155 636 100 Plus
Dper\GL17594-PA 202 GL17594-PA 75..156 63..143 190 45.1 Plus
Dper\GL22632-PA 204 GL22632-PA 71..166 51..155 173 37 Plus
Dper\GL22631-PA 500 GL22631-PA 143..215 67..138 161 38.4 Plus
Dper\GL18037-PA 163 GL18037-PA 56..144 52..144 157 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12823-PA 193 GA12823-PA 74..193 36..155 636 100 Plus
Dpse\GA18238-PA 187 GA18238-PA 75..156 63..143 192 45.1 Plus
Dpse\GA18011-PA 204 GA18011-PA 71..166 51..155 173 37 Plus
Dpse\GA18002-PA 498 GA18002-PA 143..215 67..138 161 38.4 Plus
Dpse\GA20330-PA 154 GA20330-PA 47..135 52..144 156 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22970-PA 192 GM22970-PA 41..192 2..155 638 85.7 Plus
Dsec\GM15521-PA 187 GM15521-PA 75..161 63..148 193 43.7 Plus
Dsec\GM24880-PA 403 GM24880-PA 127..202 67..141 175 40.8 Plus
Dsec\GM24881-PA 211 GM24881-PA 74..164 51..141 161 39.1 Plus
Dsec\GM25000-PA 154 GM25000-PA 47..135 52..144 149 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24875-PA 115 GD24875-PA 1..115 41..155 599 99.1 Plus
Dsim\GD25025-PA 187 GD25025-PA 75..161 63..148 193 43.7 Plus
Dsim\GD12932-PA 391 GD12932-PA 73..148 67..141 175 40.8 Plus
Dsim\GD12933-PA 211 GD12933-PA 74..164 51..141 161 39.1 Plus
Dsim\GD14033-PA 154 GD14033-PA 47..135 52..144 149 39.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15970-PA 193 GJ15970-PA 74..193 36..155 635 99.2 Plus
Dvir\GJ21096-PA 189 GJ21096-PA 77..171 63..154 196 44.2 Plus
Dvir\GJ11478-PA 532 GJ11478-PA 173..243 67..136 175 42.3 Plus
Dvir\GJ11477-PA 199 GJ11477-PA 91..186 61..150 170 36.5 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 91..166 67..141 167 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25198-PA 194 GK25198-PA 74..194 36..155 624 98.3 Plus
Dwil\GK23172-PA 187 GK23172-PA 75..156 63..143 188 43.9 Plus
Dwil\GK16565-PA 471 GK16565-PA 141..213 67..138 164 41.1 Plus
Dwil\GK17636-PA 186 GK17636-PA 70..145 67..141 150 39.5 Plus
Dwil\GK21206-PA 155 GK21206-PA 48..136 52..144 148 38.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15853-PA 192 GE15853-PA 41..192 2..155 638 85.7 Plus
Dyak\GE11545-PA 187 GE11545-PA 75..161 63..148 193 43.7 Plus
Dyak\GE21250-PA 208 GE21250-PA 74..164 51..141 163 39.1 Plus
Dyak\GE21249-PA 448 GE21249-PA 126..195 67..135 160 40 Plus
Dyak\GE21638-PA 154 GE21638-PA 47..135 52..144 151 39.4 Plus

MIP15662.hyp Sequence

Translation from 0 to 467

> MIP15662.hyp
SMEAFTRTLQNTFRSTRTTRTTTTTTTNSSTSSTTNSALPSRIPKQQNYV
SDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKS
DTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLI
PIAHK*

MIP15662.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PC 154 CG14207-PC 1..154 2..155 771 100 Plus
CG14207-PB 192 CG14207-PB 54..192 11..155 650 91.7 Plus
CG14207-PD 183 CG14207-PD 58..183 30..155 631 100 Plus
CG14207-PA 183 CG14207-PA 58..183 30..155 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 63..148 194 43.7 Plus