Clone MIP15814 Report

Search the DGRC for MIP15814

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:158
Well:14
Vector:pOT2
Associated Gene/Transcriptdia-RC
Protein status:MIP15814.pep: gold
Sequenced Size:628

Clone Sequence Records

MIP15814.complete Sequence

628 bp assembled on 2009-12-22

GenBank Submission: BT120071.1

> MIP15814.complete
CGGTCTGTGCGCTGCTCTCGAACACTTGTAAACAAGGAACAGCTGTGCAA
GTTGTCTCCCCCAAAATATTGAAGACTGCGCAGGCCCCAAAAATCGTTGT
TTGGTCTTTGTTTAGTTTTCGCCTAGCTATCCAACGAAATGCGCCTCAAA
AAGCTGGGAATGTCTCGTCACGAGAAAACGAAATCCACGGGCGGCGGGCT
CCTGGACAGTCTGTTCGGAAGACCCTCGAAGTCCAAGGGAGGAACCATCA
GCAGTGGCACCCTGGCCCATGGCGGACGACCCGTGTCCGCGGACAACTAT
GTGGTGCCGGGCGTGGAGGACTTTGAGCAGTACATCCAGCAGCTAAGCGT
TGCGGAGCTGGATGCGAAGTTTCTGGAGATCATCGAGGACATGAACATTC
CGAAGGACAAGAGGGAGCCCCTGTTGGCCAAATCGAAGGAGGAGCGACAG
AAGATGATTATGTGGCACTTGAAAGGTAAAGAACATGGTGCAAGTACACG
TTTTCAAACAGAAAACCGCATTTGTGTTTGAAGATTGAGTATCGTTTGGC
TAAGAACTATAGTTCTGGAATAGAAAGTCTAAGAATAATCTACATACATA
TACGAATAAAAAAAAAAAAAAAAAAAAA

MIP15814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
dia.a 4408 dia.a 16..495 1..480 2400 100 Plus
dia-RA 4819 dia-RA 538..860 158..480 1615 100 Plus
dia.b 5034 dia.b 538..860 158..480 1615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20759029..20759478 158..607 2250 100 Plus
chr2L 23010047 chr2L 20758805..20758962 1..158 790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:19:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20760524..20760975 158..609 2260 100 Plus
2L 23513712 2L 20760300..20760457 1..158 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20760524..20760975 158..609 2260 100 Plus
2L 23513712 2L 20760300..20760457 1..158 790 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:59:57 has no hits.

MIP15814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:01:25 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20758805..20758962 1..158 100 -> Plus
chr2L 20759030..20759478 159..607 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-22 10:32:14 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RB 1..334 160..491 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:40:46 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RB 1..334 160..491 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:56:41 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RC 1..393 139..531 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:14 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RC 1..393 139..531 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-22 10:32:13 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RA 509..852 149..491 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:40:46 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RA 509..852 149..491 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:56:41 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RC 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:14 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
dia-RC 1..607 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:01:25 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20760300..20760457 1..158 100 -> Plus
2L 20760525..20760973 159..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:01:25 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20760300..20760457 1..158 100 -> Plus
2L 20760525..20760973 159..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:01:25 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20760300..20760457 1..158 100 -> Plus
2L 20760525..20760973 159..607 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:56:41 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20760525..20760973 159..607 100   Plus
arm_2L 20760300..20760457 1..158 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:35 Download gff for MIP15814.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20760525..20760973 159..607 100   Plus
2L 20760300..20760457 1..158 100 -> Plus

MIP15814.hyp Sequence

Translation from 138 to 530

> MIP15814.hyp
MRLKKLGMSRHEKTKSTGGGLLDSLFGRPSKSKGGTISSGTLAHGGRPVS
ADNYVVPGVEDFEQYIQQLSVAELDAKFLEIIEDMNIPKDKREPLLAKSK
EERQKMIMWHLKGKEHGASTRFQTENRICV*

MIP15814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
dia-PC 130 CG1768-PC 1..130 1..130 670 100 Plus
dia-PD 1098 CG1768-PD 1..126 1..123 594 93.7 Plus
dia-PE 1091 CG1768-PE 1..119 8..123 560 93.3 Plus
dia-PB 1091 CG1768-PB 1..119 8..123 560 93.3 Plus
dia-PA 1091 CG1768-PA 1..119 8..123 560 93.3 Plus

MIP15814.pep Sequence

Translation from 138 to 530

> MIP15814.pep
MRLKKLGMSRHEKTKSTGGGLLDSLFGRPSKSKGGTISSGTLAHGGRPVS
ADNYVVPGVEDFEQYIQQLSVAELDAKFLEIIEDMNIPKDKREPLLAKSK
EERQKMIMWHLKGKEHGASTRFQTENRICV*

MIP15814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15354-PA 1089 GF15354-PA 1..120 8..123 447 71.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21250-PA 1088 GG21250-PA 1..119 8..123 577 90.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11618-PA 1094 GH11618-PA 1..123 8..123 351 58.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
dia-PC 130 CG1768-PC 1..130 1..130 670 100 Plus
dia-PD 1098 CG1768-PD 1..126 1..123 594 93.7 Plus
dia-PE 1091 CG1768-PE 1..119 8..123 560 93.3 Plus
dia-PB 1091 CG1768-PB 1..119 8..123 560 93.3 Plus
dia-PA 1091 CG1768-PA 1..119 8..123 560 93.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17921-PA 1095 GI17921-PA 1..123 8..123 376 64.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18518-PA 1090 GL18518-PA 1..119 8..123 461 73.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14608-PA 1090 GA14608-PA 1..119 8..123 461 73.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23367-PA 454 GM23367-PA 1..119 8..123 577 92.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24279-PA 1090 GD24279-PA 1..119 8..123 581 92.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17693-PA 1092 GJ17693-PA 1..124 8..126 376 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14913-PA 1089 GK14913-PA 1..122 8..126 468 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12345-PA 1090 GE12345-PA 1..119 8..123 583 92.4 Plus