Clone MIP16504 Report

Search the DGRC for MIP16504

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:165
Well:4
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG11052-RA
Protein status:MIP16504.pep: gold
Sequenced Size:802

Clone Sequence Records

MIP16504.complete Sequence

802 bp assembled on 2010-01-28

GenBank Submission: BT120236.1

> MIP16504.complete
TTGACAATAAGAAAACGTAACTTTTGCTATTGTTTTTGTTTTACCTTGTT
CAAGTCATTTCATTTAAAATGTACTGTTTTTAAAGCCATTGAAATTCAAG
GTGACCCAAAAAAAAACCCTCAATCCCTATCGACCTATCGATTTTTGACA
GTTTCCGCTCCAAATATGTTAAATATACGAGTTGTAAAATGACCTCCCAA
GAAACGCAGACTGAGGGTGAACGTAGGAGGGTAACTCTTCCATCTTCGAC
ACCAGATAAAGGTACACCATCCAAAAAAGGCAGCGAGGAGCCCAACCGAA
TTTCGAACACAGAGTTCCAAAAAAGAGTAACATCGGACAGAAGCGATGAG
CCGGTCTTCAGCTGCCAATTCGAAGTGTTCGGCATTGTGCAAGGCGTTTC
ATTTCGAATGTACACCTTGCGAAGAGCTCAAAAGCTGGGAGTCCGGGGTT
GGTGCAAAAACACCAACGAGAATACGGTGAAGGGCGAAATTCAAGCACAC
CGACATTCCTTTGAGTCCATGCGCCTCTGGCTAAAGCACACCGGCAGCCC
CACCAGTCGAATTGACAAATGCATTTTCAGTGAGACTACAGAACTTTCAG
AATTCACGTTCACTAACTTCTCCATAGTGGTGGATTAGTTGTTCTCTAAA
AGCTTAAAATCATTTAGAAACGGAATTGAATTTTTCTTACACACACTTAT
ACAGTATTTGGATATGAGCTACAAATTTTTCTATTGTTATAATATTAAAT
CTAACTAAAATGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

MIP16504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11052.a 696 CG11052.a 75..693 152..770 3080 99.8 Plus
CG11052-RA 606 CG11052-RA 1..603 168..770 3000 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3834890..3835283 394..1 1955 99.7 Minus
chr3R 27901430 chr3R 3834302..3834544 763..521 1215 100 Minus
chr3R 27901430 chr3R 3834595..3834706 521..410 560 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8008846..8009239 394..1 1955 99.7 Minus
3R 32079331 3R 8008251..8008500 770..521 1235 99.6 Minus
3R 32079331 3R 8008551..8008662 521..410 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7749677..7750070 394..1 1955 99.7 Minus
3R 31820162 3R 7749082..7749331 770..521 1235 99.6 Minus
3R 31820162 3R 7749382..7749493 521..410 560 100 Minus
Blast to na_te.dros performed 2019-03-16 11:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 948..1012 82..18 118 64.6 Minus

MIP16504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:26:33 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3834302..3834544 521..763 100 <- Minus
chr3R 3834596..3834705 411..520 100 <- Minus
chr3R 3834820..3834836 394..410 100 <- Minus
chr3R 3834891..3835283 1..393 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 09:24:30 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..450 189..638 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:10 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..450 189..638 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:34:11 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RB 1..450 189..638 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:47 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RB 1..450 189..638 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 09:24:28 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..575 189..763 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:10 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..575 189..763 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:34:11 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..763 1..763 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:47 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
CG11052-RA 1..763 1..763 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:33 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8008258..8008500 521..763 100 <- Minus
3R 8008552..8008661 411..520 100 <- Minus
3R 8008776..8008792 394..410 100 <- Minus
3R 8008847..8009239 1..393 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:33 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8008258..8008500 521..763 100 <- Minus
3R 8008552..8008661 411..520 100 <- Minus
3R 8008776..8008792 394..410 100 <- Minus
3R 8008847..8009239 1..393 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:26:33 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8008258..8008500 521..763 100 <- Minus
3R 8008552..8008661 411..520 100 <- Minus
3R 8008776..8008792 394..410 100 <- Minus
3R 8008847..8009239 1..393 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:34:11 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3833980..3834222 521..763 100 <- Minus
arm_3R 3834274..3834383 411..520 100 <- Minus
arm_3R 3834498..3834514 394..410 100 <- Minus
arm_3R 3834569..3834961 1..393 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:52 Download gff for MIP16504.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7749089..7749331 521..763 100 <- Minus
3R 7749383..7749492 411..520 100 <- Minus
3R 7749607..7749623 394..410 100 <- Minus
3R 7749678..7750070 1..393 99   Minus

MIP16504.pep Sequence

Translation from 188 to 637

> MIP16504.pep
MTSQETQTEGERRRVTLPSSTPDKGTPSKKGSEEPNRISNTEFQKRVTSD
RSDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGE
IQAHRHSFESMRLWLKHTGSPTSRIDKCIFSETTELSEFTFTNFSIVVD*

MIP16504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16871-PA 150 GF16871-PA 1..150 1..149 433 54.3 Plus
Dana\GF14085-PA 119 GF14085-PA 6..117 34..146 251 42.5 Plus
Dana\GF19668-PA 116 GF19668-PA 2..99 52..149 248 46.9 Plus
Dana\GF18541-PA 102 GF18541-PA 1..100 47..146 238 45 Plus
Dana\GF12022-PA 108 GF12022-PA 6..98 54..146 193 41.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24762-PA 149 GG24762-PA 1..149 1..149 706 87.2 Plus
Dere\GG16952-PA 102 GG16952-PA 10..100 56..146 258 51.6 Plus
Dere\GG23897-PA 119 GG23897-PA 2..99 52..149 247 48 Plus
Dere\GG10375-PA 124 GG10375-PA 21..122 45..146 247 45.1 Plus
Dere\GG20418-PA 107 GG20418-PA 7..97 56..146 188 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15191-PA 141 GH15191-PA 26..136 33..147 382 59.1 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..94 56..146 282 56 Plus
Dgri\GH11746-PA 124 GH11746-PA 32..122 56..146 228 42.9 Plus
Dgri\GH11331-PA 99 GH11331-PA 7..97 56..146 225 42.9 Plus
Dgri\GH19786-PA 95 GH19786-PA 2..72 79..149 180 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11052-PD 149 CG11052-PD 1..149 1..149 781 100 Plus
CG11052-PC 149 CG11052-PC 1..149 1..149 781 100 Plus
CG11052-PB 149 CG11052-PB 1..149 1..149 781 100 Plus
CG11052-PA 149 CG11052-PA 1..149 1..149 781 100 Plus
CG34161-PC 125 CG34161-PC 6..123 29..146 243 39.8 Plus
CG34161-PA 125 CG34161-PA 6..123 29..146 243 39.8 Plus
Acyp-PB 120 CG16870-PB 6..99 56..149 240 48.9 Plus
Acyp-PA 120 CG16870-PA 6..99 56..149 240 48.9 Plus
Acyp2-PB 102 CG18505-PB 10..100 56..146 233 44 Plus
Acyp2-PA 102 CG18505-PA 10..100 56..146 233 44 Plus
CG34161-PB 120 CG34161-PB 6..118 29..146 221 39 Plus
CG18371-PA 110 CG18371-PA 6..98 54..146 197 43 Plus
CG14022-PB 101 CG14022-PB 14..99 61..146 162 36 Plus
CG14022-PA 101 CG14022-PA 14..99 61..146 162 36 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10195-PA 96 GI10195-PA 4..95 56..147 249 45.7 Plus
Dmoj\GI22288-PA 120 GI22288-PA 4..97 56..149 247 52.1 Plus
Dmoj\GI17837-PA 99 GI17837-PA 7..97 56..146 225 45.1 Plus
Dmoj\GI22495-PA 64 GI22495-PA 3..58 92..147 181 55.4 Plus
Dmoj\GI21180-PA 110 GI21180-PA 4..98 52..146 179 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22340-PA 143 GL22340-PA 1..140 1..146 384 51.3 Plus
Dper\GL22235-PA 102 GL22235-PA 1..100 47..146 274 50 Plus
Dper\GL26404-PA 132 GL26404-PA 3..115 36..146 242 44.2 Plus
Dper\GL21249-PA 116 GL21249-PA 6..99 56..149 233 43.6 Plus
Dper\GL16721-PA 110 GL16721-PA 3..98 51..146 198 41.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27462-PB 128 GA27462-PB 1..125 1..146 281 42.2 Plus
Dpse\GA27428-PA 102 GA27428-PA 1..100 47..146 274 50 Plus
Dpse\GA28850-PA 117 GA28850-PA 3..115 36..146 236 43.4 Plus
Dpse\GA28779-PA 116 GA28779-PA 6..99 56..149 232 43.6 Plus
Dpse\GA14909-PA 110 GA14909-PA 3..98 51..146 198 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10438-PA 149 GM10438-PA 1..149 1..149 741 94 Plus
Dsec\GM15374-PA 120 GM15374-PA 2..99 52..149 245 46.9 Plus
Dsec\GM11586-PA 124 GM11586-PA 21..122 45..146 245 46.1 Plus
Dsec\GM24259-PA 102 GM24259-PA 10..100 56..146 215 44 Plus
Dsec\GM21504-PA 110 GM21504-PA 6..98 54..146 191 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19440-PA 149 GD19440-PA 1..149 1..149 745 94.6 Plus
Dsim\GD22242-PA 124 GD22242-PA 21..122 45..146 250 46.1 Plus
Dsim\Acyp-PA 120 GD23938-PA 2..99 52..149 245 46.9 Plus
Dsim\GD10999-PA 110 GD10999-PA 6..98 54..146 191 43 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23483-PA 96 GJ23483-PA 2..94 54..146 265 52.7 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 4..97 56..149 243 50 Plus
Dvir\GJ17330-PA 99 GJ17330-PA 3..97 52..146 236 44.2 Plus
Dvir\GJ10096-PA 67 GJ10096-PA 3..57 92..146 192 60 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 5..98 53..146 172 38.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14028-PA 139 GK14028-PA 1..139 1..149 378 48.7 Plus
Dwil\GK12388-PA 99 GK12388-PA 7..97 56..146 243 46.2 Plus
Dwil\GK15522-PA 126 GK15522-PA 34..124 56..146 235 48.4 Plus
Dwil\GK19418-PA 107 GK19418-PA 3..98 51..146 180 37.5 Plus
Dwil\GK18433-PA 101 GK18433-PA 9..99 56..146 177 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25751-PA 149 GE25751-PA 1..149 1..149 711 89.3 Plus
Dyak\GE24338-PA 102 GE24338-PA 10..100 56..146 260 51.6 Plus
Dyak\GE13517-PA 124 GE13517-PA 28..122 52..146 244 47.4 Plus
Dyak\GE19011-PA 120 GE19011-PA 6..99 56..149 243 48.9 Plus
Dyak\GE12579-PA 110 GE12579-PA 6..98 54..146 187 40.9 Plus

MIP16504.hyp Sequence

Translation from 188 to 637

> MIP16504.hyp
MTSQETQTEGERRRVTLPSSTPDKGTPSKKGSEEPNRISNTEFQKRVTSD
RSDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGE
IQAHRHSFESMRLWLKHTGSPTSRIDKCIFSETTELSEFTFTNFSIVVD*

MIP16504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11052-PD 149 CG11052-PD 1..149 1..149 781 100 Plus
CG11052-PC 149 CG11052-PC 1..149 1..149 781 100 Plus
CG11052-PB 149 CG11052-PB 1..149 1..149 781 100 Plus
CG11052-PA 149 CG11052-PA 1..149 1..149 781 100 Plus
CG34161-PC 125 CG34161-PC 6..123 29..146 243 39.8 Plus