MIP16558.complete Sequence
469 bp assembled on 2010-01-28
GenBank Submission: BT120244.1
> MIP16558.complete
CAATAATCCTAAATAGTATGTGGAAGTGGGAAACATTCACTCTTGTGGTA
CTGTGTAGTTTTTCGGCGGTAAAGTGCTTTGCTGAGAAAGTCGATTGTTC
AGTAAATGGAACTCAAACGGATTGCCCCACAGCTTGTCCAGAAACGTGTG
ATACCAAAGGAAAGCCCAATTGTACTTTGATATGCGGAGGTCCTTGTGTC
TGCAAGCCAGGATATGTTGTCAATAGAATGATTCCTGCCTGTGTACTGCG
ATCTGATTGTCCAAAAATCGTATTACAAAGCGACAGAGCCCGAAGACTGA
CGAATTTCAATTGCTTTAGTGGGGAAAATACTTGCACTCAACTAAAACAT
AGTAGTAGTAAGCGAAATAATGACTAACAGACAAAACAAATTATTGAGCA
CGATTTTGGCTTCTATTAAAAAATTTATGAACCCAGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA
MIP16558.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:40:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33259-RA | 383 | CG33259-RA | 1..383 | 18..400 | 1915 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:18:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 15397889..15398324 | 1..436 | 2180 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15407832..15408269 | 1..438 | 2190 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 15400932..15401369 | 1..438 | 2190 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:18:00 has no hits.
MIP16558.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:51 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 15397889..15398324 | 1..436 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 10:16:51 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..360 | 18..377 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:24 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..360 | 18..377 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:20 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..360 | 18..377 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:34 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..360 | 18..377 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 10:16:50 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..383 | 18..400 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:24 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..383 | 18..400 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:20 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..436 | 1..436 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:34 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33259-RA | 1..436 | 1..436 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15407832..15408267 | 1..436 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15407832..15408267 | 1..436 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15407832..15408267 | 1..436 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:20 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15400932..15401367 | 1..436 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:03 Download gff for
MIP16558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15400932..15401367 | 1..436 | 100 | | Plus |
MIP16558.hyp Sequence
Translation from 2 to 376
> MIP16558.hyp
IILNSMWKWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCD
TKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPKIVLQSDRARRLT
NFNCFSGENTCTQLKHSSSKRNND*
MIP16558.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33259-PA | 119 | CG33259-PA | 1..119 | 6..124 | 673 | 100 | Plus |
Acp62F-PA | 115 | CG1262-PA | 31..115 | 29..112 | 301 | 60 | Plus |
CG5267-PA | 178 | CG5267-PA | 106..169 | 29..93 | 172 | 50.8 | Plus |
CG34189-PA | 122 | CG34189-PA | 53..112 | 32..92 | 148 | 44.3 | Plus |
MIP16558.pep Sequence
Translation from 2 to 376
> MIP16558.pep
IILNSMWKWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCD
TKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPKIVLQSDRARRLT
NFNCFSGENTCTQLKHSSSKRNND*
MIP16558.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20050-PA | 106 | GF20050-PA | 22..98 | 30..106 | 189 | 51.3 | Plus |
Dana\GF19794-PA | 128 | GF19794-PA | 27..90 | 29..92 | 143 | 46.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15894-PA | 120 | GG15894-PA | 1..117 | 6..121 | 492 | 78.6 | Plus |
Dere\GG14885-PA | 131 | GG14885-PA | 24..109 | 27..111 | 255 | 55.8 | Plus |
Dere\GG20624-PA | 200 | GG20624-PA | 128..191 | 29..93 | 147 | 49.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33259-PA | 119 | CG33259-PA | 1..119 | 6..124 | 673 | 100 | Plus |
Acp62F-PA | 115 | CG1262-PA | 31..115 | 29..112 | 301 | 60 | Plus |
CG5267-PB | 201 | CG5267-PB | 129..192 | 29..93 | 172 | 50.8 | Plus |
CG34189-PA | 122 | CG34189-PA | 53..112 | 32..92 | 148 | 44.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\Acp62F-PA | 135 | GL11209-PA | 6..91 | 7..93 | 175 | 43.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\Acp62F-PA | 135 | GA24640-PA | 6..91 | 7..93 | 177 | 43.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25525-PA | 117 | GM25525-PA | 1..117 | 6..124 | 540 | 87.4 | Plus |
Dsec\Acp62F-PA | 117 | GM14509-PA | 7..117 | 7..114 | 257 | 49.1 | Plus |
Dsec\GM21718-PA | 200 | GM21718-PA | 128..191 | 29..93 | 146 | 50.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14540-PA | 118 | GD14540-PA | 1..113 | 6..118 | 551 | 92.9 | Plus |
Dsim\Acp62F-PA | 117 | GD13705-PA | 1..117 | 3..114 | 253 | 46.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18908-PA | 97 | GK18908-PA | 1..92 | 3..99 | 163 | 42.6 | Plus |
Dwil\GK19009-PA | 106 | GK19009-PA | 37..97 | 32..93 | 138 | 50 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23139-PA | 120 | GE23139-PA | 1..117 | 6..121 | 493 | 78.6 | Plus |
Dyak\GE22237-PA | 120 | GE22237-PA | 1..117 | 6..121 | 492 | 77.8 | Plus |
Dyak\GE20336-PA | 118 | GE20336-PA | 29..110 | 32..112 | 239 | 57.3 | Plus |
Dyak\GE11814-PA | 198 | GE11814-PA | 129..189 | 32..93 | 139 | 50 | Plus |