Clone MIP16558 Report

Search the DGRC for MIP16558

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:165
Well:58
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG33259-RA
Protein status:MIP16558.pep: gold
Sequenced Size:469

Clone Sequence Records

MIP16558.complete Sequence

469 bp assembled on 2010-01-28

GenBank Submission: BT120244.1

> MIP16558.complete
CAATAATCCTAAATAGTATGTGGAAGTGGGAAACATTCACTCTTGTGGTA
CTGTGTAGTTTTTCGGCGGTAAAGTGCTTTGCTGAGAAAGTCGATTGTTC
AGTAAATGGAACTCAAACGGATTGCCCCACAGCTTGTCCAGAAACGTGTG
ATACCAAAGGAAAGCCCAATTGTACTTTGATATGCGGAGGTCCTTGTGTC
TGCAAGCCAGGATATGTTGTCAATAGAATGATTCCTGCCTGTGTACTGCG
ATCTGATTGTCCAAAAATCGTATTACAAAGCGACAGAGCCCGAAGACTGA
CGAATTTCAATTGCTTTAGTGGGGAAAATACTTGCACTCAACTAAAACAT
AGTAGTAGTAAGCGAAATAATGACTAACAGACAAAACAAATTATTGAGCA
CGATTTTGGCTTCTATTAAAAAATTTATGAACCCAGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

MIP16558.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-RA 383 CG33259-RA 1..383 18..400 1915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15397889..15398324 1..436 2180 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15407832..15408269 1..438 2190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15400932..15401369 1..438 2190 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:18:00 has no hits.

MIP16558.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:51 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15397889..15398324 1..436 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 10:16:51 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..360 18..377 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:24 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..360 18..377 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:20 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..360 18..377 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:34 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..360 18..377 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 10:16:50 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..383 18..400 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:24 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..383 18..400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:20 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:34 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
CG33259-RA 1..436 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15407832..15408267 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15407832..15408267 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:51 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15407832..15408267 1..436 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:20 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15400932..15401367 1..436 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:03 Download gff for MIP16558.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15400932..15401367 1..436 100   Plus

MIP16558.hyp Sequence

Translation from 2 to 376

> MIP16558.hyp
IILNSMWKWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCD
TKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPKIVLQSDRARRLT
NFNCFSGENTCTQLKHSSSKRNND*

MIP16558.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-PA 119 CG33259-PA 1..119 6..124 673 100 Plus
Acp62F-PA 115 CG1262-PA 31..115 29..112 301 60 Plus
CG5267-PA 178 CG5267-PA 106..169 29..93 172 50.8 Plus
CG34189-PA 122 CG34189-PA 53..112 32..92 148 44.3 Plus

MIP16558.pep Sequence

Translation from 2 to 376

> MIP16558.pep
IILNSMWKWETFTLVVLCSFSAVKCFAEKVDCSVNGTQTDCPTACPETCD
TKGKPNCTLICGGPCVCKPGYVVNRMIPACVLRSDCPKIVLQSDRARRLT
NFNCFSGENTCTQLKHSSSKRNND*

MIP16558.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20050-PA 106 GF20050-PA 22..98 30..106 189 51.3 Plus
Dana\GF19794-PA 128 GF19794-PA 27..90 29..92 143 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15894-PA 120 GG15894-PA 1..117 6..121 492 78.6 Plus
Dere\GG14885-PA 131 GG14885-PA 24..109 27..111 255 55.8 Plus
Dere\GG20624-PA 200 GG20624-PA 128..191 29..93 147 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33259-PA 119 CG33259-PA 1..119 6..124 673 100 Plus
Acp62F-PA 115 CG1262-PA 31..115 29..112 301 60 Plus
CG5267-PB 201 CG5267-PB 129..192 29..93 172 50.8 Plus
CG34189-PA 122 CG34189-PA 53..112 32..92 148 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\Acp62F-PA 135 GL11209-PA 6..91 7..93 175 43.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Acp62F-PA 135 GA24640-PA 6..91 7..93 177 43.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25525-PA 117 GM25525-PA 1..117 6..124 540 87.4 Plus
Dsec\Acp62F-PA 117 GM14509-PA 7..117 7..114 257 49.1 Plus
Dsec\GM21718-PA 200 GM21718-PA 128..191 29..93 146 50.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14540-PA 118 GD14540-PA 1..113 6..118 551 92.9 Plus
Dsim\Acp62F-PA 117 GD13705-PA 1..117 3..114 253 46.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18908-PA 97 GK18908-PA 1..92 3..99 163 42.6 Plus
Dwil\GK19009-PA 106 GK19009-PA 37..97 32..93 138 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23139-PA 120 GE23139-PA 1..117 6..121 493 78.6 Plus
Dyak\GE22237-PA 120 GE22237-PA 1..117 6..121 492 77.8 Plus
Dyak\GE20336-PA 118 GE20336-PA 29..110 32..112 239 57.3 Plus
Dyak\GE11814-PA 198 GE11814-PA 129..189 32..93 139 50 Plus