Clone MIP16559 Report

Search the DGRC for MIP16559

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:165
Well:59
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34021-RA
Protein status:MIP16559.pep: gold
Sequenced Size:695

Clone Sequence Records

MIP16559.complete Sequence

695 bp assembled on 2010-01-28

GenBank Submission: BT120261.1

> MIP16559.complete
TGAATATGGATGTCACGAAAACATCAAGCGCTGAGGAAACCGAAAACACG
GAAAATACTAGTCATGCTAAAAACATTAACGAAAACGTATCAAAATTTTA
TGAAACTATTGGAAATATTTCCCGAAATATGCGCAAGGACGATTGGACAT
ATCTACAACGCCATCCAGAGATCCGAGCCATAATTCGGGTCATTACAGCC
GAGGCGGTTAAGGCAAAGCCATCGAATATCTACCAATTTACAGCCAATTT
ATTTGGAAGCGAAAGAGACGAGGAGATGGTAGAAAAGATAAACAAGCAAC
TTAAGTGGTTGGAAGAGCAGTTGCGAGGGGGTACGTGGAATCCTGACGAA
GGATGTGCCCCGTTTCCAGAATCCAGCGAGACTTCTTCGGAAACTAAATG
CCAAACTAATTTTAATACCACTGCGAGTTTCAACATACCCGAAAAGCAAG
TTTGCCCTGAAAATTATAAGCCAGATTGCAAGAAATGTTAAAAATGTGAA
CTTAATAAATTCAAAAAAAAAAAATTCAGATTGCAAGAAATGTTAAAAAT
GTGAACTTAATAAATTCAAAAAAAAAAAAAATCAGATTGCAAGAAATGTT
AAAAATGTGAACTTAATAAATTCAAAAAACTTTTTAAAAGGAATAAAAAA
TATTTGTAATTAAATTATAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16559.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34021-RA 696 CG34021-RA 93..696 1..604 3020 100 Plus
CG34021-RA 696 CG34021-RA 564..665 527..629 460 98 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8224595..8224977 286..668 1915 100 Plus
chr2R 21145070 chr2R 8224241..8224527 1..287 1435 100 Plus
chr2R 21145070 chr2R 8224781..8224882 527..629 450 98.1 Plus
chr2R 21145070 chr2R 8224836..8224938 472..573 450 98.1 Plus
chr2R 21145070 chr2R 8224892..8224938 472..518 235 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12337336..12337719 286..669 1920 100 Plus
2R 25286936 2R 12336982..12337268 1..287 1435 100 Plus
2R 25286936 2R 12337522..12337623 527..629 450 98.1 Plus
2R 25286936 2R 12337577..12337679 472..573 450 98.1 Plus
2R 25286936 2R 12337633..12337679 472..518 235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12338535..12338918 286..669 1920 100 Plus
2R 25260384 2R 12338181..12338467 1..287 1435 100 Plus
Blast to na_te.dros performed 2019-03-16 10:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3878..4004 636..512 126 58.9 Minus
McClintock 6450 McClintock McCLINTOCK 6450bp 1785..1908 480..603 125 59.1 Plus

MIP16559.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:23:05 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8224241..8224527 1..287 100 -> Plus
chr2R 8224597..8224921 288..612 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 13:48:09 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..486 6..491 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:57 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..486 6..491 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:34:28 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..486 6..491 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:33 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..486 6..491 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 13:48:07 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..486 6..491 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:57 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 1..668 1..668 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:34:28 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 93..760 1..668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:33 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
CG34021-RA 93..760 1..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:23:05 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12336982..12337268 1..287 100 -> Plus
2R 12337338..12337718 288..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:23:05 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12336982..12337268 1..287 100 -> Plus
2R 12337338..12337718 288..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:23:05 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12336982..12337268 1..287 100 -> Plus
2R 12337338..12337718 288..668 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:34:28 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8224487..8224773 1..287 100 -> Plus
arm_2R 8224843..8225223 288..668 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:26 Download gff for MIP16559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12338181..12338467 1..287 100 -> Plus
2R 12338537..12338917 288..668 100   Plus

MIP16559.hyp Sequence

Translation from 2 to 490

> MIP16559.hyp
NMDVTKTSSAEETENTENTSHAKNINENVSKFYETIGNISRNMRKDDWTY
LQRHPEIRAIIRVITAEAVKAKPSNIYQFTANLFGSERDEEMVEKINKQL
KWLEEQLRGGTWNPDEGCAPFPESSETSSETKCQTNFNTTASFNIPEKQV
CPENYKPDCKKC*

MIP16559.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34021-PA 161 CG34021-PA 1..161 2..162 863 100 Plus
CG34012-PA 158 CG34012-PA 24..124 31..129 199 42.6 Plus

MIP16559.pep Sequence

Translation from 2 to 490

> MIP16559.pep
NMDVTKTSSAEETENTENTSHAKNINENVSKFYETIGNISRNMRKDDWTY
LQRHPEIRAIIRVITAEAVKAKPSNIYQFTANLFGSERDEEMVEKINKQL
KWLEEQLRGGTWNPDEGCAPFPESSETSSETKCQTNFNTTASFNIPEKQV
CPENYKPDCKKC*

MIP16559.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19817-PA 157 GF19817-PA 1..156 4..159 476 59.9 Plus
Dana\GF24571-PA 158 GF24571-PA 26..124 33..129 214 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20276-PA 158 GG20276-PA 1..158 2..162 642 83.3 Plus
Dere\GG13937-PA 158 GG13937-PA 24..124 31..129 202 42.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22811-PA 157 GH22811-PA 25..157 34..159 290 44 Plus
Dgri\GH14642-PA 156 GH14642-PA 19..133 26..145 235 38.3 Plus
Dgri\GH23291-PA 156 GH23291-PA 19..133 26..145 234 38.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34021-PA 161 CG34021-PA 1..161 2..162 863 100 Plus
CG34012-PA 158 CG34012-PA 24..124 31..129 199 42.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21187-PA 159 GI21187-PA 36..159 35..159 322 49.2 Plus
Dmoj\GI11626-PA 156 GI11626-PA 19..133 26..139 205 36.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15304-PA 169 GL15304-PA 1..161 2..159 338 51.5 Plus
Dper\GL22846-PA 155 GL22846-PA 23..121 33..129 201 42.4 Plus
Dper\GL22844-PA 155 GL22844-PA 23..121 33..129 201 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29042-PA 169 GA29042-PA 1..161 2..159 348 52.8 Plus
Dpse\GA23890-PA 155 GA23890-PA 23..121 33..129 201 42.4 Plus
Dpse\GA23887-PA 155 GA23887-PA 23..121 33..129 201 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21361-PA 161 GM21361-PA 1..161 2..162 789 92.5 Plus
Dsec\GM24772-PA 158 GM24772-PA 24..124 31..129 194 40.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10858-PA 161 GD10858-PA 1..161 2..162 790 92.5 Plus
Dsim\GD12823-PA 158 GD12823-PA 24..124 31..129 201 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11308-PA 156 GJ11308-PA 24..133 31..139 218 40 Plus
Dvir\GJ20788-PA 127 GJ20788-PA 29..127 27..159 189 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24509-PA 144 GK24509-PA 1..143 29..159 357 46.2 Plus
Dwil\GK20535-PA 154 GK20535-PA 22..122 31..129 196 41.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12436-PA 159 GE12436-PA 1..159 2..162 696 82.1 Plus
Dyak\GE20236-PA 158 GE20236-PA 24..124 31..129 200 42.6 Plus