Clone MIP16568 Report

Search the DGRC for MIP16568

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:165
Well:68
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42464-RA
Protein status:MIP16568.pep: gold
Sequenced Size:324

Clone Sequence Records

MIP16568.complete Sequence

324 bp assembled on 2011-03-07

GenBank Submission: BT126153.1

> MIP16568.complete
AATCTAAACAAAGTTTTACCGGGAAAAAGATGTTCATCAATATATGGTAT
TTATTCATAGCATTAGCTGGTGTTAATGCGGAATCAGCAGATGAAATCTG
TCAACTTACGCCTGAGGCTAATGGCTTTGGGAAAATTATGTCCTGTGCAC
ACTACTCGAATTGGTTTTCCTATCATTCAGATAAAAACGAATGTCTGGAG
TTTTCATACGGAGGCTGTGGTGGCAACGAAAATAGGTTTCAAACTAAAGC
AATTTGCGAAGATCTCTGCAAAAATAAAGTTGAGCAGCTTTGAATAATGT
AAGAAAAAAAAAAAAAAAAAAAAA

MIP16568.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3699128..3699337 93..302 1035 99.5 Plus
chr2L 23010047 chr2L 3698973..3699065 1..93 435 97.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3699619..3699833 93..307 1060 99.5 Plus
2L 23513712 2L 3699464..3699556 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3699619..3699833 93..307 1060 99.5 Plus
2L 23513712 2L 3699464..3699556 1..93 465 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:20:03 has no hits.

MIP16568.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:05 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3698973..3699065 1..93 97 -> Plus
chr2L 3699129..3699337 94..303 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:35 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..264 30..293 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:32 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..264 30..293 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:00 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..264 30..293 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:35 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..264 30..293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:32 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..300 1..300 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:00 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 1..300 1..300 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:05 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3699464..3699556 1..93 100 -> Plus
2L 3699620..3699828 94..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:05 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3699464..3699556 1..93 100 -> Plus
2L 3699620..3699828 94..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:05 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3699464..3699556 1..93 100 -> Plus
2L 3699620..3699828 94..303 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:32 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3699464..3699556 1..93 100 -> Plus
arm_2L 3699620..3699828 94..303 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:42 Download gff for MIP16568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3699620..3699828 94..303 99   Plus
2L 3699464..3699556 1..93 100 -> Plus

MIP16568.hyp Sequence

Translation from 2 to 292

> MIP16568.hyp
SKQSFTGKKMFINIWYLFIALAGVNAESADEICQLTPEANGFGKIMSCAH
YSNWFSYHSDKNECLEFSYGGCGGNENRFQTKAICEDLCKNKVEQL*

MIP16568.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42464-PA 87 CG42464-PA 1..87 10..96 484 100 Plus
CG16713-PA 82 CG16713-PA 8..80 16..89 179 45.9 Plus
CG16712-PB 82 CG16712-PB 3..81 11..90 174 46.2 Plus
CG16712-PA 82 CG16712-PA 3..81 11..90 174 46.2 Plus
Acp24A4-PC 78 CG31779-PC 8..76 16..89 136 42.7 Plus

MIP16568.pep Sequence

Translation from 2 to 292

> MIP16568.pep
SKQSFTGKKMFINIWYLFIALAGVNAESADEICQLTPEANGFGKIMSCAH
YSNWFSYHSDKNECLEFSYGGCGGNENRFQTKAICEDLCKNKVEQL*

MIP16568.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14654-PA 82 GF14654-PA 3..81 11..90 171 45 Plus
Dana\GF19682-PA 82 GF19682-PA 2..80 9..89 159 45.7 Plus
Dana\GF15247-PA 82 GF15247-PA 22..81 30..90 152 47.5 Plus
Dana\GF14655-PA 81 GF14655-PA 9..79 17..89 149 41.1 Plus
Dana\GF14656-PA 88 GF14656-PA 2..88 8..91 137 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24413-PA 82 GG24413-PA 2..80 9..89 162 46.9 Plus
Dere\GG24412-PA 82 GG24412-PA 3..80 11..89 161 45.6 Plus
Dere\GG24409-PA 82 GG24409-PA 3..80 11..89 161 45.6 Plus
Dere\GG24415-PA 82 GG24415-PA 3..80 11..89 156 45.6 Plus
Dere\GG24414-PA 82 GG24414-PA 3..80 11..89 151 46.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13180-PA 81 GH13180-PA 3..80 11..89 153 41.8 Plus
Dgri\GH25268-PA 83 GH25268-PA 2..83 9..91 149 39.8 Plus
Dgri\GH22481-PA 83 GH22481-PA 2..83 9..91 149 39.8 Plus
Dgri\GH13181-PA 83 GH13181-PA 2..83 9..91 149 39.8 Plus
Dgri\GH25267-PA 79 GH25267-PA 30..78 42..90 135 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42464-PA 87 CG42464-PA 1..87 10..96 484 100 Plus
CG16713-PA 82 CG16713-PA 8..80 16..89 179 45.9 Plus
IM33-PB 82 CG16712-PB 3..81 11..90 174 46.2 Plus
IM33-PA 82 CG16712-PA 3..81 11..90 174 46.2 Plus
Acp24A4-PC 78 CG31779-PC 8..76 16..89 136 42.7 Plus
Acp24A4-PB 78 CG31779-PB 8..76 16..89 136 42.7 Plus
CG3513-PA 88 CG3513-PA 6..88 11..91 134 35.7 Plus
CG17380-PB 119 CG17380-PB 4..75 12..89 133 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17757-PA 82 GI17757-PA 3..81 11..90 181 42.5 Plus
Dmoj\GI23877-PA 82 GI23877-PA 3..81 11..90 160 40 Plus
Dmoj\GI17759-PA 82 GI17759-PA 22..80 30..89 155 50 Plus
Dmoj\GI17761-PA 64 GI17761-PA 15..63 42..90 129 46.9 Plus
Dmoj\GI17758-PA 82 GI17758-PA 22..80 30..89 128 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19459-PA 82 GL19459-PA 3..81 11..90 172 42.5 Plus
Dper\GL19427-PA 78 GL19427-PA 2..77 9..90 167 43.9 Plus
Dper\GL19462-PA 82 GL19462-PA 22..80 30..89 135 48.3 Plus
Dper\GL19465-PA 79 GL19465-PA 30..78 42..90 132 49 Plus
Dper\GL19463-PA 79 GL19463-PA 31..78 43..90 130 54.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14098-PA 82 GA14098-PA 3..81 11..90 171 43.8 Plus
Dpse\GA25956-PA 78 GA25956-PA 2..77 9..90 162 43.9 Plus
Dpse\GA25971-PA 82 GA25971-PA 22..80 30..89 133 48.3 Plus
Dpse\GA25973-PA 79 GA25973-PA 30..78 42..90 132 49 Plus
Dpse\GA25972-PA 79 GA25972-PA 31..78 43..90 130 54.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18128-PA 82 GM18128-PA 2..80 9..89 169 44.4 Plus
Dsec\GM18127-PA 82 GM18127-PA 3..81 11..90 162 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22735-PA 82 GD22735-PA 2..80 9..89 169 44.4 Plus
Dsim\GD22734-PA 82 GD22734-PA 3..81 11..90 161 42.5 Plus
Dsim\Acp24A4-PA 78 GD22736-PA 2..76 9..89 143 42 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17585-PA 82 GJ17585-PA 3..80 11..89 165 44.3 Plus
Dvir\GJ17586-PA 82 GJ17586-PA 22..80 30..89 141 46.7 Plus
Dvir\GJ16350-PA 79 GJ16350-PA 30..78 42..90 134 51 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14815-PA 82 GE14815-PA 3..81 11..90 172 46.2 Plus
Dyak\GE14816-PA 82 GE14816-PA 2..80 9..89 162 46.9 Plus
Dyak\GE17972-PA 84 GE17972-PA 22..82 30..89 133 45.9 Plus