Clone MIP16624 Report

Search the DGRC for MIP16624

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:24
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42634-RA
Protein status:MIP16624.pep: gold
Sequenced Size:1049

Clone Sequence Records

MIP16624.complete Sequence

1049 bp assembled on 2010-01-28

GenBank Submission: BT120241.1

> MIP16624.complete
ATCAGGTCGCAAATTGTGTGAAAATAGTTTTCTAAATTCAAAATTCAAGT
CTCTTGGTCATGTCCTCGTCTGTGGATCACGTGGTACACCACGTACTGGC
CCCAATGGCAATCAACGTCCTCGATCGCGTGGTGCCAGTAATCCGCCAAT
TGGTGATCATCATGCATCAGGCATTTCTGGTTGATCACCATGTGTCGGAG
CCCGTGATCGATGTATCCGGCATGATTCAGCCCGTTCGTAAAATAGTCTT
GATTGTAAACGATTCAACGCCGGAGCACCATGTCGACCAGGAGCAGGTGG
TCAGTTCGGATGACATTAACTACCTGATAAATGAAATTTCGCGAAGTATC
CGAAACTTGGCCCGTTCGACCTATAATACCATCTCGGCGATGGCTGGAGA
GTAGCCCTAGAATTATTTGTCATCGTGGTCGATCGAAAAATCCGACATCG
ACCCTCCTGATCCTCCAGAAGATCCTGCTCCTTTGCCCAAGATATGGAAA
TGGTTCACACGGCCATCGGAGTTGCGGGCATAGTGGCCCTGTTTATGGTA
GTTTCCCGTTCGTTAACTGAAGTGGGTGGCAGGGTGTTAAACCAAACCCG
TGATCCGATCGCTGACCTTGTGAGGCGCGGTGGTCCAGTGGCGGATCAGC
TGTCCGCCGTCGAGGGCGAAACTCCTCTAGTAGAGGGCGATCGCATGGAT
GGCGCCTGCTCCGTGGTACAAAGTATTGGAGGCAAGGCATGTGCCTTTGT
AGGACCATTGCTTCCTAAGTTTGGCAGTGAACATAATTCCGAGGGCTCCT
CCAAGGAAGACGAAAAGGATAAAAAGGACTCGGAACCGGTAGTAGTAAAA
CCTGAAACACCGCCAGCGGCAGAATTAACCGAAGAGGAGTAGGATCTAGT
CAGCAACTATGTCGAATAGAAAGCAAAAAAAAGGAAATTTTTAGTTTTCT
CTAGTTGGCCTTGGAAATAAACTTCACTCATCTTGTGGGCTTTGTGGGAT
TCGAAACCTAGAGAGCTCATTCATTTTGAAAAAAAAAAAAAAAAAAAAA

MIP16624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-RA 1028 CG42635-RA 1..1028 1..1028 5140 100 Plus
CG42634-RA 1028 CG42634-RA 1..1028 1..1028 5140 100 Plus
CG31740-RA 771 CG31740-RA 1..177 854..1030 885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18006580..18007607 1..1028 5125 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007935..18008964 1..1030 5150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007935..18008964 1..1030 5150 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:48:50 has no hits.

MIP16624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:49:32 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18006580..18007607 1..1028 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 09:43:54 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:19 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..399 494..892 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:44 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..399 494..892 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:04 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RB 1..399 494..892 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 09:43:54 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG15149-RA 1..334 60..393 100 == Plus
CG15149-RA 335..765 463..892 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:18 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:44 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:04 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
CG42634-RA 1..1028 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:32 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:32 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:32 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:44 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007935..18008962 1..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:59 Download gff for MIP16624.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007935..18008962 1..1028 100   Plus

MIP16624.pep Sequence

Translation from 59 to 403

> MIP16624.pep
MSSSVDHVVHHVLAPMAINVLDRVVPVIRQLVIIMHQAFLVDHHVSEPVI
DVSGMIQPVRKIVLIVNDSTPEHHVDQEQVVSSDDINYLINEISRSIRNL
ARSTYNTISAMAGE*

MIP16624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14809-PA 259 GF14809-PA 1..112 1..113 183 38.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21100-PA 254 GG21100-PA 1..114 1..114 502 88.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42634-PA 114 CG42634-PA 1..114 1..114 568 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14598-PA 156 GL14598-PA 21..156 9..113 154 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25205-PA 156 GA25205-PA 21..156 9..113 148 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17257-PA 254 GM17257-PA 1..114 1..114 550 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24122-PA 200 GD24122-PA 1..68 1..68 305 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18903-PA 105 GK18903-PA 7..103 12..113 172 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12804-PA 254 GE12804-PA 1..114 1..114 491 86 Plus

MIP16624.hyp Sequence

Translation from 493 to 891

> MIP16624.hyp
MEMVHTAIGVAGIVALFMVVSRSLTEVGGRVLNQTRDPIADLVRRGGPVA
DQLSAVEGETPLVEGDRMDGACSVVQSIGGKACAFVGPLLPKFGSEHNSE
GSSKEDEKDKKDSEPVVVKPETPPAAELTEEE*

MIP16624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-PA 132 CG42635-PA 1..132 1..132 668 100 Plus
CG42635-PB 132 CG42635-PB 1..132 1..132 668 100 Plus