Clone MIP16633 Report

Search the DGRC for MIP16633

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:33
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG16837-RA
Protein status:MIP16633.pep: gold
Sequenced Size:614

Clone Sequence Records

MIP16633.complete Sequence

614 bp assembled on 2010-01-27

GenBank Submission: BT120218.1

> MIP16633.complete
CATCAAATCAAATAGGTCAAAACCTAGTTGGCTGGGAAGAGGACACTACT
ATACTCACTACTAGTTACATTTGCGAAGCCCGAAAATGTCCAGAAGTTCG
AGGTTATCAGTAACTGAAACTCAGCGCAAAAGCACTCCAGTGGTAAAGAA
GGCGGTTATTCGCAGTCGATCCTACGATGGGGATGCGTTCGTCAATCTCT
TCGCCCATCGCGGCGCCCGAGACATCATGATCTTGGATAGCCATGGAGTG
CCCCTCCGATCCACCTGCAGTCAGAGACGCACCTTCGTGTTCGTCTCTAA
CCTGAAGCCGCTGCTCTTCATGGCCCGCAACGTGGTCAGGGATCTGGACC
CCTCGAACGACATAACCTTCATGCGGATTCGCTCCAATATGGGCGAAATC
CACATGACCCTGGGCACGGACTTCATTTTGATCGTTGTGCAGAAGCTGAG
GAGGCTCAGGAGCAGCTCAACATCATAAAACATTTCCGGTCGCTGTGCGT
GTGTGTGTGCGGATGTTAATTGTACTGTATCCATATTCCACCCAAATTAA
ATTGCATGCAATTGCGGCAAATGAGCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

MIP16633.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-RA 562 CG16837-RA 1..561 19..579 2805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20361502..20361918 160..576 2010 98.8 Plus
chr2R 21145070 chr2R 20361272..20361430 1..159 795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24475616..24476035 160..579 2100 100 Plus
2R 25286936 2R 24475386..24475544 1..159 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24476815..24477234 160..579 2100 100 Plus
2R 25260384 2R 24476585..24476743 1..159 795 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:10:54 has no hits.

MIP16633.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:12:03 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20361272..20361430 1..159 100 -> Plus
chr2R 20361502..20361918 160..576 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:56 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..393 86..478 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:36 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..393 86..478 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:44 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..393 86..478 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:00 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..393 86..478 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:56 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..525 41..565 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:36 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..525 41..565 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:44 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..576 1..576 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:00 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
CG16837-RA 1..576 1..576 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:03 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24475386..24475544 1..159 100 -> Plus
2R 24475616..24476032 160..576 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:03 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24475386..24475544 1..159 100 -> Plus
2R 24475616..24476032 160..576 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:03 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24475386..24475544 1..159 100 -> Plus
2R 24475616..24476032 160..576 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:44 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20362909..20363067 1..159 100 -> Plus
arm_2R 20363139..20363555 160..576 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:29 Download gff for MIP16633.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24476833..24477249 160..576 100   Plus
2R 24476603..24476761 1..159 100 -> Plus

MIP16633.hyp Sequence

Translation from 85 to 477

> MIP16633.hyp
MSRSSRLSVTETQRKSTPVVKKAVIRSRSYDGDAFVNLFAHRGARDIMIL
DSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRS
NMGEIHMTLGTDFILIVVQKLRRLRSSSTS*

MIP16633.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-PA 130 CG16837-PA 1..130 1..130 644 100 Plus
robl-PA 97 CG10751-PA 14..93 40..119 175 42.5 Plus

MIP16633.pep Sequence

Translation from 85 to 477

> MIP16633.pep
MSRSSRLSVTETQRKSTPVVKKAVIRSRSYDGDAFVNLFAHRGARDIMIL
DSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRS
NMGEIHMTLGTDFILIVVQKLRRLRSSSTS*

MIP16633.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19843-PA 133 GF19843-PA 1..127 1..123 473 74.8 Plus
Dana\GF13122-PA 97 GF13122-PA 14..93 40..119 178 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22968-PA 131 GG22968-PA 1..129 1..128 587 88.4 Plus
Dere\GG20680-PA 100 GG20680-PA 17..96 40..119 178 42.5 Plus
Dere\GG21147-PA 115 GG21147-PA 11..94 33..119 132 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21001-PA 114 GH21001-PA 2..109 16..122 326 58.3 Plus
Dgri\GH21399-PA 97 GH21399-PA 14..93 40..119 178 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG16837-PA 130 CG16837-PA 1..130 1..130 644 100 Plus
robl-PA 97 CG10751-PA 14..93 40..119 175 42.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20640-PA 116 GI20640-PA 20..112 30..122 333 61.3 Plus
Dmoj\GI18578-PA 108 GI18578-PA 25..104 40..119 178 42.5 Plus
Dmoj\GI16945-PA 110 GI16945-PA 13..73 40..100 140 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20138-PA 81 GL20138-PA 1..74 50..123 252 62.2 Plus
Dper\GL11426-PA 97 GL11426-PA 14..93 40..119 178 42.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14173-PB 120 GA14173-PB 17..113 27..123 346 62.9 Plus
Dpse\GA10543-PA 97 GA10543-PA 14..93 40..119 178 42.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11862-PA 130 GM11862-PA 1..129 1..129 634 96.1 Plus
Dsec\GM21776-PA 97 GM21776-PA 14..93 40..119 178 42.5 Plus
Dsec\GM26651-PA 97 GM26651-PA 14..93 40..119 178 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11860-PA 130 GD11860-PA 1..128 1..128 635 96.9 Plus
Dsim\GD11269-PA 97 GD11269-PA 14..93 40..119 178 42.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21607-PA 119 GJ21607-PA 1..116 1..123 352 55.3 Plus
Dvir\GJ20372-PA 97 GJ20372-PA 14..93 40..119 178 42.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19463-PA 124 GK19463-PA 16..113 26..123 391 69.4 Plus
Dwil\GK22899-PA 97 GK22899-PA 14..93 40..119 178 42.5 Plus
Dwil\GK19376-PA 116 GK19376-PA 7..93 33..119 143 26.4 Plus
Dwil\GK14988-PA 97 GK14988-PA 15..94 41..120 138 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14408-PA 133 GE14408-PA 1..131 1..128 565 84 Plus
Dyak\GE11664-PA 97 GE11664-PA 14..93 40..119 178 42.5 Plus