Clone MIP16647 Report

Search the DGRC for MIP16647

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:47
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG31515-RB
Protein status:MIP16647.pep: gold
Sequenced Size:486

Clone Sequence Records

MIP16647.complete Sequence

486 bp assembled on 2010-01-28

GenBank Submission: BT120251.1

> MIP16647.complete
GCATTTGGGATGTAAGTTCCAAGCCATGCGGATCAATCTCATCTACTTCA
CGCTGCTTTGGGCATTCTTCTTCTCAACCGAAGTATTTGGAAAGGTTAAA
ATACGAGAGTCCGATATACGACGTATAACAAAGATGGGAAGCTACAAGGT
ACGCCAAGAAAAATGTTTGTTCATACCCAGCTATGGACGCTGCAAAAAAC
ATATCGCAGTATATGGCTACAACATTATAACCAATCGATGCTCAGAATTT
ACCTACAGTGGCTGCGGGGGGAATCCCAATCGTTTTATGACTGATAGCCA
ATGTCGAAACACTTGCTATGTGGTTCCAGCGAGGAAAACCGTCTCAGAAC
CGGACTATTATGCCGATGACGGTGTCACAGAACCGATGCAAGTGGATGAA
GAGGACGATTACTAATTTGTAAGTTTGTGCATAAGTTCTTATACAAAAAA
TATAAGCATGTTGAGCGAAAAAAAAAAAAAAAAAAA

MIP16647.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515.a 489 CG31515.a 19..484 1..466 2330 100 Plus
CG31515-RA 447 CG31515-RA 189..447 157..415 1295 100 Plus
CG31515-RA 447 CG31515-RA 1..133 26..158 665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19211761..19212070 466..157 1550 100 Minus
chr3R 27901430 chr3R 19212126..19212283 158..1 760 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23388374..23388683 466..157 1550 100 Minus
3R 32079331 3R 23388739..23388896 158..1 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23129205..23129514 466..157 1550 100 Minus
3R 31820162 3R 23129570..23129727 158..1 790 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:16:03 has no hits.

MIP16647.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:16:58 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19211760..19212068 159..467 99 <- Minus
chr3R 19212126..19212283 1..158 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 12:14:19 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RA 1..133 26..158 100 -> Plus
CG31515-RA 191..447 159..415 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:40 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 1..390 26..415 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:53 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 1..390 26..415 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:14 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 1..390 26..415 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 12:14:17 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RA 1..133 26..158 100 -> Plus
CG31515-RA 191..447 159..415 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:40 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 3..468 1..467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:53 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 3..468 1..467 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:14 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 3..468 1..467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:58 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23388373..23388681 159..467 99 <- Minus
3R 23388739..23388896 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:58 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23388373..23388681 159..467 99 <- Minus
3R 23388739..23388896 1..158 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:58 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23388373..23388681 159..467 99 <- Minus
3R 23388739..23388896 1..158 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:53 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19214095..19214403 159..467 99 <- Minus
arm_3R 19214461..19214618 1..158 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:13 Download gff for MIP16647.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23129204..23129512 159..467 99 <- Minus
3R 23129570..23129727 1..158 100   Minus

MIP16647.hyp Sequence

Translation from 0 to 414

> MIP16647.hyp
HLGCKFQAMRINLIYFTLLWAFFFSTEVFGKVKIRESDIRRITKMGSYKV
RQEKCLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQ
CRNTCYVVPARKTVSEPDYYADDGVTEPMQVDEEDDY*

MIP16647.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515-PB 129 CG31515-PB 1..129 9..137 704 100 Plus
CG31609-PB 123 CG31609-PB 24..94 48..116 178 45.1 Plus
CG17380-PB 119 CG17380-PB 17..75 47..105 155 45.8 Plus

MIP16647.pep Sequence

Translation from 1 to 414

> MIP16647.pep
HLGCKFQAMRINLIYFTLLWAFFFSTEVFGKVKIRESDIRRITKMGSYKV
RQEKCLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQ
CRNTCYVVPARKTVSEPDYYADDGVTEPMQVDEEDDY*

MIP16647.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18766-PA 116 GF18766-PA 1..116 9..137 269 44.2 Plus
Dana\GF22706-PA 117 GF22706-PA 25..82 50..107 164 51.7 Plus
Dana\GF16246-PA 169 GF16246-PA 2..95 22..112 140 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25331-PA 123 GG25331-PA 26..93 50..116 164 45.6 Plus
Dere\GG20657-PA 762 GG20657-PA 640..696 52..108 141 45.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13263-PA 102 GH13263-PA 23..84 50..111 179 51.6 Plus
Dgri\GH22839-PA 769 GH22839-PA 642..698 49..105 140 42.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515-PB 129 CG31515-PB 1..129 9..137 704 100 Plus
CG31609-PB 123 CG31609-PB 24..94 48..116 178 45.1 Plus
CG17380-PB 119 CG17380-PB 17..75 47..105 155 45.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17461-PA 123 GI17461-PA 48..104 54..110 175 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12882-PA 121 GL12882-PA 22..82 47..107 168 47.5 Plus
Dper\GL13851-PA 99 GL13851-PA 11..87 47..121 164 42.9 Plus
Dper\GL13634-PA 104 GL13634-PA 1..94 13..105 133 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22617-PA 112 GA22617-PA 22..110 47..137 172 39.1 Plus
Dpse\GA26823-PA 99 GA26823-PA 11..87 47..121 161 42.9 Plus
Dpse\GA30093-PA 120 GA30093-PA 42..96 51..105 139 45.5 Plus
Dpse\GA25574-PA 104 GA25574-PA 1..94 13..105 134 33 Plus
Dpse\GA30053-PB 93 GA30053-PB 29..83 51..105 132 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23568-PA 129 GM23568-PA 1..129 9..137 534 76.7 Plus
Dsec\GM17400-PA 169 GM17400-PA 23..83 47..107 163 44.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18384-PA 146 GD18384-PA 1..146 9..137 508 68.5 Plus
Dsim\GD23586-PA 180 GD23586-PA 23..83 47..107 163 44.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14412-PA 119 GJ14412-PA 39..118 49..123 178 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15065-PA 203 GK15065-PA 87..141 51..105 151 45.5 Plus
Dwil\GK14112-PA 179 GK14112-PA 2..102 5..114 138 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23958-PA 130 GE23958-PA 1..130 9..137 523 75.4 Plus
Dyak\GE18825-PA 184 GE18825-PA 26..83 50..107 166 48.3 Plus